Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.85
PubTator Score 1.17

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6685 4.9e-178
mucosa-associated lymphoid tissue lymphoma 480 8.0e-03


  Differential Expression (2)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... -1.048 8.0e-03
psoriasis -4.500 4.9e-178

Gene RIF (2)

22621930 A phenylalanine (Phe-391) in UGT3A2 favors UDP-Glc use.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

FLLGLTLGTLWLCGKLLGMAVWWLRGARKVKET                                         491 - 523

Text Mined References (10)

PMID Year Title
22621930 2012 Identification of residues that confer sugar selectivity to UDP-glycosyltransferase 3A (UGT3A) enzymes.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.