Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.01
PubTator Score 4.38

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 4.3e-19
osteosarcoma 7933 4.2e-05
psoriasis 6685 9.3e-05


  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.205 4.2e-05
psoriasis -1.100 9.3e-05
facioscapulohumeral dystrophy 5.100 4.3e-19

Gene RIF (5)

22621930 An asparagine (Asn-391) in the UGT signature sequence of UGT3A1 is necessary for utilization of UDP-GlcNAc.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19814657 UGT3A1 is involved in drug metabolism and uses UDP N-acetylglucosamine as a sugar donor
18981171 UDP glycosyltransferase 3A1 is a UDP N-acetylglucosaminyltransferase

AA Sequence

FLLGLTLGTMWLCGKLLGVVARWLRGARKVKKT                                         491 - 523

Text Mined References (10)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
22621930 2012 Identification of residues that confer sugar selectivity to UDP-glycosyltransferase 3A (UGT3A) enzymes.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19814657 2010 UGT3A: novel UDP-glycosyltransferases of the UGT superfamily.
18981171 2008 Identification of UDP glycosyltransferase 3A1 as a UDP N-acetylglucosaminyltransferase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.