Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.99
PubTator Score 4.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 4.3e-19
osteosarcoma 7950 4.2e-05
psoriasis 6694 9.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
facioscapulohumeral dystrophy 5.100 4.3e-19
osteosarcoma 1.205 4.2e-05
psoriasis -1.100 9.3e-05

Gene RIF (5)

AA Sequence

MVGQRVLLLVAFLLSGVLLSEAAKILTISTLGGSHYLLLDRVSQILQEHGHNVTMLHQSGKFLIPDIKEE      1 - 70
EKSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIMDSLKNENYD     71 - 140
LVFVEAFDFCSFLIAEKLVKPFVAILPTTFGSLDFGLPSPLSYVPVFPSLLTDHMDFWGRVKNFLMFFSF    141 - 210
SRSQWDMQSTFDNTIKEHFPEGSRPVLSHLLLKAELWFVNSDFAFDFARPLLPNTVYIGGLMEKPIKPVP    211 - 280
QDLDNFIANFGDAGFVLVAFGSMLNTHQSQEVLKKMHNAFAHLPQGVIWTCQSSHWPRDVHLATNVKIVD    281 - 350
WLPQSDLLAHPSIRLFVTHGGQNSVMEAIRHGVPMVGLPVNGDQHGNMVRVVAKNYGVSIRLNQVTADTL    351 - 420
TLTMKQVIEDKRYKSAVVAASVILHSQPLSPAQRLVGWIDHILQTGGATHLKPYAFQQPWHEQYLIDVFV    421 - 490
FLLGLTLGTMWLCGKLLGVVARWLRGARKVKKT                                         491 - 523
//

Text Mined References (10)

PMID Year Title