Property Summary

NCBI Gene PubMed Count 143
PubMed Score 210.69
PubTator Score 308.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
ulcerative colitis -1.573 3.1e-02
facioscapulohumeral dystrophy -2.200 1.0e-02

Gene RIF (138)

PMID Text
26407805 UGT2B7 contributes to the in-vitro glucuronidation of arctigenin in liver/intestinal microsomes.
26303110 Influence of valproic acid concentration and polymorphism of UGT1A4*3, UGT2B7 -161C > T and UGT2B7*2 on serum concentration of lamotrigine in Chinese epileptic children
26220143 Kinetic analyses revealed very low Km value for 16alpha-hydroxyestrone glucuronidation by UGT2B7, below 4 muM, suggesting higher affinity than commonly found among UGTs and their substrates
26176234 This descriptive study examines correlations between concentrations of tamoxifen's glucuronide metabolites and genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 in 132 patients with estrogen receptor-positive breast cancer under treatment with tamoxifen
26088889 These results suggested that UGT2B7 C802T may be an important determinant of individual variability in the pharmacokinetics of VPA
26053558 aprepitant can alter clearance of drugs primarily eliminated by UGT2B7.
26010150 in tumor liver microsomes from HCC patients, either V(max) (maximum reaction rate, R(max) for UGT1A1) or clearance rates (V(max)/K(m), Clint) of UGT1A, UGT1A1, UGT1A4, UGT1A9 and UGT2B7 were lower than those in the adjacent normal liver microsomes
25935875 Results show ticagrelor pharmacokinetics to be influenced by SNPs in UGT2B7 though no detectable effects on efficacy or safety were found
25823783 This study revealed that three polymorphisms, SCN1A IVS5-91G>A, ABCC2 c.1249 G>A and UGT2B7 c.802T>C, are associated with OXC maintenance dose and lnCDR in Han Chinese epilepsy patients
25752520 Significant differences in mean dose consumption were seen among the genotypic groups of the OPRM1 A118G and UGT2B7 C802T variants. These variants were found to predict codeine consumption in the cohort overall and among Caucasians
25713207 Provide further evidence supporting UGT2B7 as a p53 target gene.
25340733 Our small pilot study illustrates that in addition to gestational and postnatal age, the UGT2B7 -900G>A polymorphism significantly alters morphine pharmacokinetics in preterm infants.
24561451 We identified three novel single-nucleotide polymorphisms (SNPs) in the UDP-glucuronosyltransferase 2B7 (UGT2B7) gene.
24366439 The list of proteins immunoprecipitated with the anti-UGT2B7 antibody.
24365988 These data suggest that the UGT2B7 -161C>T polymorphism in pediatric epilepsy patients carrying the CYP2C9*1/*1 genotype affects VPA concentration.
24256307 The presence of the SNP 802C>T UGT2B7 (UGT2B7*2/*2) is associated with a worse analgesic response to transdermal buprenorphine in the postoperative period of thoracic surgery.
24128937 data indicate UGT2B7 pre-mRNAs are subject to differential splicing in normal, fetal and neoplastic tissues and that 2 mutually exclusive promoters drive UGT2B7 expression; data also indicate a switch toward functional enzyme upon maturation in the kidney and reversal of this process in neoplastic cells
24088326 A novel autoregulatory mechanism of the UGT2B7 glucuronidation pathway.
23981985 study reveals UGT2B7 A268G genetic polymorphism distribution in Chinese epilepsy population; UGT2B7 A268G plays an important role in valproic acid (VPA) metabolism, and has certain effects on VPA's serum concentration
23965986 Carbinol glucuronidation activity significantly correlated with UGT2B7 protein.
23726609 log-rank test and hazard ratio were used to reflect association between UGT2B7 802C>T variant and risk of acute graft rejection
23700788 the UGT2B7*2 variant allele was significantly rarer in Chinese than in Caucasians and Africans
23686330 By considering COMT, OPRM1, and UGT2B7 genotypes, as well as pharmacokinetic results, only COMT polymorphisms appear to be predictive of morphine need in postoperative pain therapy.
23263737 UGT2B7 SNPs influence lamotrigine pharmacokinetics in Thai patients.
23230132 UGT1A9 and 2B7 are the main enzymes involved in ethanol glucuronidation. In addition, our results suggest that cannabinol and cannabidiol could significantly alter ethanol glucuronidation.
23223495 Report UGT2B7 expression in fetal/adult tissues.
23131697 genetic association studies in pediatric population in United States: Data suggest that combined SNPs in UGT2B7, UGT1A9, and MRP2 are important in pharmacokinetics/biotransformation of prodrug mycophenolate mofetil in kidney transplant recipients.
23099353 There were no differences in VPA dose or adjusted plasma VPA concentrations among the UGT2B7*2 or CYP2C9*3 genotypic groups.
22676193 These results suggest that SNPs of the UGT2B7 gene may play important roles in opiate withdrawal symptoms.
22462748 For both CYP2B6 and UGT2B7 genes, genetic variation was observed among individuals within populations, with the Papua New Guinean population showing the highest values for CYP2B6, and the Asian and European populations showing higher values for UGT2B7.
22240840 These results suggest that N-glycosylation differentially affects the glucuronidation of zidovudine and morphine by human UGT2B7.
22188362 the present study revealed that EPHX1, UGT2B7 and SCN1A genetic polymorphisms simultaneously modulated the CBZ maintenance doses and CDRs(concentration-dose ratios)
22092298 Methadone inhibits CYP2D6 and UGT2B7/2B4 in vivo
22028316 Data suggest that UGT2B7 is the predominant activity in liver microsomes for haloperidol O-glucuronidation (in both human and rat).
21881541 these findings point toward a significant variability in structure, abundance, and tissue-specific UGT2B7 transcriptome, in addition to novel functions for UGT2B7-derived proteins
21856742 In the case of UGT2B7, our results agree with the previously described effect of BSA, namely lowering the K(m) value without a large effect on the enzyme's V(max) value.
21415305 results suggest that HNF4alpha plays an important role in the constitutive expression of hepatic UGT2B7, and CAR acts as a negative regulator by interfering with HNF4alpha binding activity
21123165 Diabetes mellitus is associated with significantly reduced UGT2B7 mRNA expression, protein level, and enzymatic activity of liver and kidney.
21056984 2B7 substrate selection is not fixed but varies depending upon the tyrosine kinases that carry out its required phosphorylation
21044367 Observational study of gene-disease association. (HuGE Navigator)
20973683 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20860463 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20814162 Identification of UGT2B7 single nucleotide polymorphisms with LD and the tagging SNPs lays the foundation for investigating UGT2B7-related genotype/phenotype association studies for Koreans as well as other populations.
20814162 Observational study of genotype prevalence. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20567810 UGT2B7 and UGT1A7 heterozygosity predicted increased apparent oral clearance of mycophenolic acid (MPA).
20567810 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20565459 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20297805 The results also indicated that UGT1A1, UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2B7 are the most important six UGT isoforms for metabolizing the three dihydroxyflavones and seven monohydroxyflavones.
20216122 UGT2B7_-161C>T polymorphism is significantly associated with lamotrigine concentration-to-dose ratio.
20216122 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20147615 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20142249 Observational study of gene-disease association. (HuGE Navigator)
20064729 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20056642 Observational study of gene-disease association. (HuGE Navigator)
20008037 results suggest that UGT2B7 is the primary human hepatic UDP-glucuronosyltransferase isoform catalyzing 3-O- and 1-O-CP glucuronidation with minor contributions from UGT1A6 and UGT1A9
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19779319 findings demonstrate independent effects of CYP2A6 and UGT2B7 genetic variation on efavirenz disposition beyond that of the CYP2B6 polymorphisms.
19779319 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19730281 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19644937 analysis of stereoselective metabolism of propranolol glucuronidation by human UDP-glucuronosyltransferases 2B7 and 1A9
19628728 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19574343 Observational study of gene-disease association. (HuGE Navigator)
19494809 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19424794 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19408577 Genetic polymorphism in UDP-glucuronosyltransferase 2B7 is associated with colorectal cancer.
19352303 Genetic variations in UGT2B7 and endometrial cancer risk
19352303 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19289110 These data are consistent with Src-based 2B7 glucuronidation of genotoxic catechol estrogens in mammary gland.
19244109 Observational study of gene-disease association. (HuGE Navigator)
19225446 Observational study of gene-disease association. (HuGE Navigator)
19116784 Our results strongly suggested that UGT2B7 is not expressed in normal breast tissue.
18946804 the effect of UGT2B7 polymorphism on the pharmacokinetics of mycophenolic acid (MPA) and its metabolites phenolic glucuronide (MPAG) and acyl glucuronide (AcMPAG) in Chinese renal transplant
18946804 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18719619 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18647858 Kinetic modeling of the interactions between 4-methylumbelliferone, 1-naphthol, and zidovudine glucuronidation by UGT2B7 provides evidence for multiple substrate binding and effector sites.
18641546 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18622263 UGT2B7 is transcriptionally regulated by Nrf2, but the mechanism is hindered by polymorphisms in the promoter region of UGT2B7*2.
18622261 Haplotype 4 was associated with an increase in enzyme activity and gene expression.
18597651 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18569595 There was no relevant association between the identified UGT2B7 genotypes and increased bladder cancer occurrence in the two investigated Caucasian groups in Germany.
18569595 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18496127 Observational study of gene-disease association. (HuGE Navigator)
18315786 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18161889 Observational study of gene-disease association. (HuGE Navigator)
17978490 UGT2B7 prefers metabolizing S-carvedilol to R-carvedilol. Both A71S and H268Y mutations of UGT2B7 reduced capacity but did not affect affinity and, as a result, the efficiency of metabolism was remarkably reduced.
17965522 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17965522 UGT2B7*3 allele did not significantly affect the systemic clearance/bioavailability of carvedilol enantiomers.
17924828 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17724700 Presence of UGT2B7 -840G allele is associated with significantly reduced glucuronidation of morphine and thus contributes to the variability in hepatic clearance of morphine in sickle cell anemia.
17724700 Observational study of gene-disease association. (HuGE Navigator)
17706742 analysis of the human UDP-glucuronosyltransferase 2B7 and its inhibitors
17687269 The UGT2B7 genotype probably affects lorazepam-valproate pharmacodynamic interaction, especially in subjects who have homovariant genotypes of UGT2B7 and UGT2B15, although the effects on the pharmacokinetics are less significant.
17687269 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17670842 Results suggest that UGT2B7 is the main isozyme responsible for gemfibrozil glucuronidation in humans.
17579197 Observational study of gene-disease association. (HuGE Navigator)
17579197 The UGT2B7 H(268)Y polymorphism is independently associated with cortical bone size and serum sex steroid levels in young adult men.
17446261 Formation of (R)- and (S)-glucuronide from racemic flurbiprofen is catalyzed by UGT2B7.
17442341 Results describe the crystal structure of the cofactor-binding domain of the human phase II drug-metabolism enzyme UDP-glucuronosyltransferase 2B7.(
17440429 Provide evidence for HNF1alpha as a determinant of UGT2B7 mRNA expression, but suggest a role for multiple transcription factors.
17429314 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17363580 Observational study of gene-disease association. (HuGE Navigator)
17339869 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17329852 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17263731 Results strongly indicated that the presence of an aromatic residue at position 33 is important for the activity and specificity of UGT2B7.
17241877 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17241877 Allelic variants of UGT2B7, CYP2C8, and ABCC2, which may predispose to the formation and accumulation of reactive diclofenac metabolites are associated with diclofenac hepatotoxicity
17178267 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17115150 Observational study of genotype prevalence. (HuGE Navigator)
16849011 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16595916 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16580900 Observational study of gene-disease association. (HuGE Navigator)
16466707 Observational study of genotype prevalence. (HuGE Navigator)
16466707 These results suggest that the haplotype structure of UGT2B7 in the Japanese population is different from that of other ethnic groups.
16397224 Observational study of genotype prevalence. (HuGE Navigator)
16103897 Observational study of gene-disease association. (HuGE Navigator)
15689421 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15615884 Observational study of gene-disease association. (HuGE Navigator)
15611481 Cytochrome 450 3A4 alters UDPG glucuroyosyltransgferase regioselectivity so that the ratio of morphine activation/detoxication is increased.
15472229 UGT2B7 demonstrated the highest catalytic activities for estrogens and at least 10- to 50-fold higher activity for the conjugation of genotoxic 4-hydroxycatecholestrogens at position 4
15320866 in liver microsomes, UGT1A1 is primarily responsible for farnesol glucuronidation; however, in intestine microsomes, UGT2B7 is probably the major isoform involved
15319348 Observational study of genotype prevalence. (HuGE Navigator)
15319348 P. 1053 "...UGT2B7...is...fairly common in Caucasians...and Africans"..."but...still rare in Japanese..." P. 1054: "...genotyping...UGT2B7 in Japanese...would be useful for studies on...association between haplotypes and pharmacokinetic...paramters."
15318931 Observational study of gene-disease association. (HuGE Navigator)
15001974 Observational study of gene-disease association. (HuGE Navigator)
14871856 Observational study of gene-disease association. (HuGE Navigator)
14660172 a significant role for UGT1A9 and 2B7 in the catalysis of almokalant glucuronidation
12811366 interindividual differences in morphine glucuronidation may be the result of genetic variation in UGT2B7
12746330 two human allelic variants UGT2B7H((268)) and UGT2B7Y((268)) conjugate aldosterone, its A-ring reduced metabolites (5alpha-dihydroaldosterone and 3alpha,5beta-tetrahydroaldosterone), and both 5alpha- and 5beta-tetrahydrocortisone epimers.
12629580 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12623074 These results demonstrate for the first time glucuronidation of catechols by gastric and intestinal microsomal UGTs and three human recombinant UGT isoforms.Recombinant human UGT1A6, 1A9, and 2B7 effectively catalyzed catechol glucuronidation
12185559 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11186130 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSS      1 - 70
ALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKV     71 - 140
QESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMER    141 - 210
VKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPHPLLPNVDFVGGL    211 - 280
HCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLN    281 - 350
TRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTM    351 - 420
SSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHS    421 - 490
LDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND                                   491 - 529
//

Text Mined References (146)

PMID Year Title
26407805 2015 Identification and characterization of human UDP-glucuronosyltransferases responsible for the in-vitro glucuronidation of arctigenin.
26303110 2015 Influence of valproic acid concentration and polymorphism of UGT1A4*3, UGT2B7 -161C?>?T and UGT2B7*2 on serum concentration of lamotrigine in Chinese epileptic children.
26220143 2015 Glucuronidation of estrone and 16?-hydroxyestrone by human UGT enzymes: The key roles of UGT1A10 and UGT2B7.
26176234 2015 Impacts of the Glucuronidase Genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 on Tamoxifen Metabolism in Breast Cancer Patients.
26088889 2015 The influence of UGT2B7 genotype on valproic acid pharmacokinetics in Chinese epilepsy patients.
26053558 2015 In vitro glucuronidation of aprepitant: a moderate inhibitor of UGT2B7.
26010150 2015 Drug-Metabolizing Activity, Protein and Gene Expression of UDP-Glucuronosyltransferases Are Significantly Altered in Hepatocellular Carcinoma Patients.
25935875 2015 Effect of genetic variations on ticagrelor plasma levels and clinical outcomes.
25823783 2015 SCN1A, ABCC2 and UGT2B7 gene polymorphisms in association with individualized oxcarbazepine therapy.
25752520 2015 The pharmacogenetics of codeine pain relief in the postpartum period.
25713207 2015 Induction of human UDP-Glucuronosyltransferase 2B7 gene expression by cytotoxic anticancer drugs in liver cancer HepG2 cells.
25340733 2014 Effect of UGT2B7 -900G>A (-842G>A; rs7438135) on morphine glucuronidation in preterm newborns: results from a pilot cohort.
24561451 2014 Polymorphisms and haplotypes of the UDP-glucuronosyltransferase 2B7 gene promoter.
24366439 2014 Extensive protein-protein interactions involving UDP-glucuronosyltransferase (UGT) 2B7 in human liver microsomes.
24365988 2014 Influence of uridine diphosphate glucuronosyltransferase 2B7 -161C>T polymorphism on the concentration of valproic acid in pediatric epilepsy patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256307 2015 Influence of uridine diphosphate-glucuronyltransferase 2B7 (UGT2B7) variants on postoperative buprenorphine analgesia.
24128937 2013 Expression of UGT2B7 is driven by two mutually exclusive promoters and alternative splicing in human tissues: changes from prenatal life to adulthood and in kidney cancer.
24088326 2013 Modulation of the UGT2B7 enzyme activity by C-terminally truncated proteins derived from alternative splicing.
23981985 2013 Effect of UGT2B7 genetic variants on serum valproic acid concentration.
23965986 2013 The letrozole phase 1 metabolite carbinol as a novel probe drug for UGT2B7.
23726609 2013 Uridine diphosphate glucuronosyltransferase 2B7 variant p.His268Tyr as a predictor of kidney allograft early acute rejection.
23700788 2013 Genetic polymorphisms of UGT1A8, UGT1A9, UGT2B7 and ABCC2 in Chinese renal transplant recipients and a comparison with other ethnic populations.
23686330 2013 Genetic variability at COMT but not at OPRM1 and UGT2B7 loci modulates morphine analgesic response in acute postoperative pain.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23263737 2013 Influence of the UGT2B7 -161C>T polymorphism on the population pharmacokinetics of lamotrigine in Thai patients.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23230132 2013 Involvement of UDP-glucuronosyltransferases UGT1A9 and UGT2B7 in ethanol glucuronidation, and interactions with common drugs of abuse.
23223495 2013 Tissue distribution and relative gene expression of UDP-glucuronosyltransferases (2B7, 2B15, 2B17) in the human fetus.
23131697 2012 UGT1A9, UGT2B7, and MRP2 genotypes can predict mycophenolic acid pharmacokinetic variability in pediatric kidney transplant recipients.
23099353 2012 Effects of UGT1A6, UGT2B7, and CYP2C9 genotypes on plasma concentrations of valproic acid in Chinese children with epilepsy.
22676193 2012 UGT2B7 genetic polymorphisms are associated with the withdrawal symptoms in methadone maintenance patients.
22579593 2012 Simultaneous evaluation of six human glucuronidation activities in liver microsomes using liquid chromatography-tandem mass spectrometry.
22462748 2012 Worldwide variation in human drug-metabolism enzyme genes CYP2B6 and UGT2B7: implications for HIV/AIDS treatment.
22240840 2012 The effects of N-glycosylation on the glucuronidation of zidovudine and morphine by UGT2B7 expressed in HEK293 cells.
22188362 2012 Association of polymorphisms in EPHX1, UGT2B7, ABCB1, ABCC2, SCN1A and SCN2A genes with carbamazepine therapy optimization.
22092298 2012 Methadone inhibits CYP2D6 and UGT2B7/2B4 in vivo: a study using codeine in methadone- and buprenorphine-maintained subjects.
22028316 2012 Human UDP-glucuronosyltransferase isoforms involved in haloperidol glucuronidation and quantitative estimation of their contribution.
21881541 2011 Transcriptional diversity at the UGT2B7 locus is dictated by extensive pre-mRNA splicing mechanisms that give rise to multiple mRNA splice variants.
21856742 2011 Bovine serum albumin decreases Km values of human UDP-glucuronosyltransferases 1A9 and 2B7 and increases Vmax values of UGT1A9.
21415305 2011 Inhibition of human UGT2B7 gene expression in transgenic mice by the constitutive androstane receptor.
21123165 2011 Diabetes mellitus reduces activity of human UDP-glucuronosyltransferase 2B7 in liver and kidney leading to decreased formation of mycophenolic acid acyl-glucuronide metabolite.
21056984 2011 Regulated phosphorylation of a major UDP-glucuronosyltransferase isozyme by tyrosine kinases dictates endogenous substrate selection for detoxification.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20973683 2010 Pharmacogenetic impact of UDP-glucuronosyltransferase metabolic pathway and multidrug resistance-associated protein 2 transport pathway on mycophenolic acid in thoracic transplant recipients: an exploratory study.
20860463 2010 Influence of host genetic factors on efavirenz plasma and intracellular pharmacokinetics in HIV-1-infected patients.
20814162 2010 Genetic variations in UDP-glucuronosyltransferase 2B7 gene (UGT2B7) in a Korean population.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20567810 2010 Effects of uridine diphosphate glucuronosyltransferase 2B7 and 1A7 pharmacogenomics and patient clinical parameters on steady-state mycophenolic acid pharmacokinetics in glomerulonephritis.
20565459 2010 Risk of diarrhoea in a long-term cohort of renal transplant patients given mycophenolate mofetil: the significant role of the UGT1A8 2 variant allele.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20308471 2010 Role of UDP-glucuronosyltransferase isoforms in 13-cis retinoic acid metabolism in humans.
20297805 2010 Use of glucuronidation fingerprinting to describe and predict mono- and dihydroxyflavone metabolism by recombinant UGT isoforms and human intestinal and liver microsomes.
20216122 2010 UGT2B7_-161C>T polymorphism is associated with lamotrigine concentration-to-dose ratio in a multivariate study.
20147615 2010 Population pharmacokinetics and pharmacogenetics of mycophenolic acid following administration of mycophenolate mofetil in de novo pediatric renal-transplant patients.
20142249 2010 Associations between polymorphisms in glucuronidation and sulfation enzymes and mammographic breast density in premenopausal women in the United States.
20064729 2010 Genetic factors associated with drug-resistance of epilepsy: relevance of stratification by patient age and aetiology of epilepsy.
20056724 2010 Phase II metabolism of hesperetin by individual UDP-glucuronosyltransferases and sulfotransferases and rat and human tissue samples.
20056642 2010 Genetic variation of genes involved in dihydrotestosterone metabolism and the risk of prostate cancer.
20008037 2010 Identification of human UGT2B7 as the major isoform involved in the O-glucuronidation of chloramphenicol.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19779319 2009 CYP2B6, CYP2A6 and UGT2B7 genetic polymorphisms are predictors of efavirenz mid-dose concentration in HIV-infected patients.
19730281 2009 Genetic polymorphisms of MRP2 and UGT2B7 and gastrointestinal symptoms in renal transplant recipients taking mycophenolic acid.
19644937 2010 Stereoselective metabolism of propranolol glucuronidation by human UDP-glucuronosyltransferases 2B7 and 1A9.
19628728 2009 Interindividual variability in pharmacokinetics of generic nucleoside reverse transcriptase inhibitors in TB/HIV-coinfected Ghanaian patients: UGT2B7*1c is associated with faster zidovudine clearance and glucuronidation.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19494809 2009 UGT1A9 -275T>A/-2152C>T polymorphisms correlate with low MPA exposure and acute rejection in MMF/tacrolimus-treated kidney transplant patients.
19424794 2010 Genetic polymorphisms in phase I and phase II enzymes and breast cancer risk associated with menopausal hormone therapy in postmenopausal women.
19408577 2009 Genetic polymorphism in UDP-glucuronosyltransferase 2B7 and colorectal cancer risk.
19352303 2009 Genetic variations in UGT1A1 and UGT2B7 and endometrial cancer risk.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19289110 2009 Src supports UDP-glucuronosyltransferase-2B7 detoxification of catechol estrogens associated with breast cancer.
19244109 2009 Functional significance of UDP-glucuronosyltransferase variants in the metabolism of active tamoxifen metabolites.
19225446 2009 UGT genotype may contribute to adverse events following medication with mycophenolate mofetil in pediatric kidney transplant recipients.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19116784 2009 UGT2B7 is not expressed in normal breast.
18946804 2008 Influence of uridine diphosphate (UDP)-glucuronosyltransferases and ABCC2 genetic polymorphisms on the pharmacokinetics of mycophenolic acid and its metabolites in Chinese renal transplant recipients.
18719619 2009 Pharmacogenetics of neonatal opioid toxicity following maternal use of codeine during breastfeeding: a case-control study.
18647858 2008 Kinetic modeling of the interactions between 4-methylumbelliferone, 1-naphthol, and zidovudine glucuronidation by udp-glucuronosyltransferase 2B7 (UGT2B7) provides evidence for multiple substrate binding and effector sites.
18641546 2008 AcylMPAG plasma concentrations and mycophenolic acid-related side effects in patients undergoing renal transplantation are not related to the UGT2B7-840G>A gene polymorphism.
18622263 2008 Genetic polymorphisms in the 5'-flanking region of human UDP-glucuronosyltransferase 2B7 affect the Nrf2-dependent transcriptional regulation.
18622261 2008 Single nucleotide polymorphism discovery and functional assessment of variation in the UDP-glucuronosyltransferase 2B7 gene.
18597651 2008 Pharmacokinetics of mycophenolate mofetil and its glucuronide metabolites in healthy volunteers.
18569595 2008 UDP-glucuronosyltransferase 2B7 C802T (His268Tyr) polymorphism in bladder cancer cases.
18496127 2008 Genetic aspects of epitestosterone formation and androgen disposition: influence of polymorphisms in CYP17 and UGT2B enzymes.
18315786 2008 No pharmacokinetic interactions between mycophenolic acid and tacrolimus in renal transplant recipients.
18161889 2008 Detoxification enzyme polymorphisms are not involved in duodenal adenomatosis in familial adenomatous polyposis.
18052087 Disposition of flavonoids via enteric recycling: enzyme stability affects characterization of prunetin glucuronidation across species, organs, and UGT isoforms.
17978490 2007 Stereoselective metabolism of racemic carvedilol by UGT1A1 and UGT2B7, and effects of mutation of these enzymes on glucuronidation activity.
17965522 2007 UGT2B7*3 did not affect the pharmacokinetics of R- and S-carvedilol in healthy Japanese.
17924828 2007 C-440T/T-331C polymorphisms in the UGT1A9 gene affect the pharmacokinetics of mycophenolic acid in kidney transplantation.
17724700 2008 UGT2B7 promoter variant -840G>A contributes to the variability in hepatic clearance of morphine in patients with sickle cell disease.
17706742 2007 Eudismic analysis of tricyclic sesquiterpenoid alcohols: lead structures for the design of potent inhibitors of the human UDP-glucuronosyltransferase 2B7.
17687269 2008 Pharmacokinetic and pharmacodynamic interaction of lorazepam and valproic acid in relation to UGT2B7 genetic polymorphism in healthy subjects.
17670842 2007 The UDP-glucuronosyltransferase 2B7 isozyme is responsible for gemfibrozil glucuronidation in the human liver.
17579197 2007 Sex steroid levels and cortical bone size in young men are associated with a uridine diphosphate glucuronosyltransferase 2B7 polymorphism (H268Y).
17446261 2007 Predominant contribution of UDP-glucuronosyltransferase 2B7 in the glucuronidation of racemic flurbiprofen in the human liver.
17442341 2007 Crystal structure of the cofactor-binding domain of the human phase II drug-metabolism enzyme UDP-glucuronosyltransferase 2B7.
17440429 2008 Hepatocyte nuclear factor-1 alpha is associated with UGT1A1, UGT1A9 and UGT2B7 mRNA expression in human liver.
17429314 2007 Influence of the UGT2B7 promoter region and exon 2 polymorphisms and comedications on Acyl-MPAG production in vitro and in adult renal transplant patients.
17363580 2007 Association of CYP1B1 germ line mutations with hepatocyte nuclear factor 1alpha-mutated hepatocellular adenoma.
17339869 2007 The impact of UGT1A8, UGT1A9, and UGT2B7 genetic polymorphisms on the pharmacokinetic profile of mycophenolic acid after a single oral dose in healthy volunteers.
17329852 2007 Evaluation of effects of polymorphism for metabolic enzymes on pharmacokinetics of carvedilol by population pharmacokinetic analysis.
17263731 2007 Substrate specificity of the human UDP-glucuronosyltransferase UGT2B4 and UGT2B7. Identification of a critical aromatic amino acid residue at position 33.
17241877 2007 Genetic susceptibility to diclofenac-induced hepatotoxicity: contribution of UGT2B7, CYP2C8, and ABCC2 genotypes.
17178267 2006 ABCB1 and cytochrome P450 genotypes and phenotypes: influence on methadone plasma levels and response to treatment.
17115150 2007 Prevalence of UGT1A9 and UGT2B7 nonsynonymous single nucleotide polymorphisms in West African, Papua New Guinean, and North American populations.
16849011 2006 Contribution of polymorphisms in UDP-glucuronosyltransferase and CYP2D6 to the individual variation in disposition of carvedilol.
16595916 2006 Multiple regression analysis of pharmacogenetic variability of carvedilol disposition in 54 healthy Japanese volunteers.
16580900 2006 Environmental and genetic factors associated with morphine response in the postoperative period.
16466707 2006 Haplotype analysis of UDP-glucuronocyltransferase 2B7 gene (UGT2B7) polymorphisms in healthy Japanese subjects.
16397224 2006 Characterization of common UGT1A8, UGT1A9, and UGT2B7 variants with different capacities to inactivate mutagenic 4-hydroxylated metabolites of estradiol and estrone.
16103897 2005 Clinical response to morphine in cancer patients and genetic variation in candidate genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15689421 2005 Inhibition of voltage-gated potassium currents by gambierol in mouse taste cells.
15615884 2005 An association of UDP-glucuronosyltransferase 2B7 C802T (His268Tyr) polymorphism with bladder cancer in benzidine-exposed workers in China.
15611481 2005 Modulation of UDP-glucuronosyltransferase function by cytochrome P450: evidence for the alteration of UGT2B7-catalyzed glucuronidation of morphine by CYP3A4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15472229 2004 Specificity and regioselectivity of the conjugation of estradiol, estrone, and their catecholestrogen and methoxyestrogen metabolites by human uridine diphospho-glucuronosyltransferases expressed in endometrium.
15320866 2004 Farnesol is glucuronidated in human liver, kidney and intestine in vitro, and is a novel substrate for UGT2B7 and UGT1A1.
15319348 2004 Single nucleotide polymorphisms and haplotype frequencies of UGT2B4 and UGT2B7 in a Japanese population.
15318931 2004 UDP-glucuronosyltransferase and sulfotransferase polymorphisms, sex hormone concentrations, and tumor receptor status in breast cancer patients.
15001974 2004 A novel functional polymorphism in the uridine diphosphate-glucuronosyltransferase 2B7 promoter with significant impact on promoter activity.
14871856 2004 Correlation between UDP-glucuronosyltransferase genotypes and 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone glucuronidation phenotype in human liver microsomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660172 2003 Almokalant glucuronidation in human liver and kidney microsomes: evidence for the involvement of UGT1A9 and 2B7.
12811366 2003 A pharmacogenetic study of uridine diphosphate-glucuronosyltransferase 2B7 in patients receiving morphine.
12746330 2003 Human uridine diphosphate-glucuronosyltransferase UGT2B7 conjugates mineralocorticoid and glucocorticoid metabolites.
12629580 2003 Sequence variations in the UDP-glucuronosyltransferase 2B7 (UGT2B7) gene: identification of 10 novel single nucleotide polymorphisms (SNPs) and analysis of their relevance to morphine glucuronidation in cancer patients.
12623074 2003 Glucuronidation of catechols by human hepatic, gastric, and intestinal microsomal UDP-glucuronosyltransferases (UGT) and recombinant UGT1A6, UGT1A9, and UGT2B7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12185559 2002 Morphine glucuronide-to-morphine plasma ratios are unaffected by the UGT2B7 H268Y and UGT1A1*28 polymorphisms in cancer patients on chronic morphine therapy.
11883901 2002 Nuclear UDP-glucuronosyltransferases: identification of UGT2B7 and UGT1A6 in human liver nuclear membranes.
11186130 2000 Genetic polymorphism of UDP-glucuronosyltransferase 2B7 (UGT2B7) at amino acid 268: ethnic diversity of alleles and potential clinical significance.
10833461 2000 Isolation and characterization of the human UGT2B7 gene.
10779377 2000 Octamer transcription factor-1 enhances hepatic nuclear factor-1alpha-mediated activation of the human UDP glucuronosyltransferase 2B7 promoter.
10748067 2000 Polymorphic gene regulation and interindividual variation of UDP-glucuronosyltransferase activity in human small intestine.
10222050 1999 Expression of UDP-glucuronosyltransferases (UGTs) 2B7 and 1A6 in the human brain and identification of 5-hydroxytryptamine as a substrate.
10024527 1999 Regulation and function of family 1 and family 2 UDP-glucuronosyltransferase genes (UGT1A, UGT2B) in human oesophagus.
8674824 1995 Expression of transcripts encoding steroid UDP-glucuronosyltransferases in human prostate hyperplastic tissue and the LNCaP cell line.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7835904 1994 Isolation of a human YAC contig encompassing a cluster of UGT2 genes and its regional localization to chromosome 4q13.
2159463 1990 Cloning and expression of human liver UDP-glucuronosyltransferase in COS-1 cells. 3,4-catechol estrogens and estriol as primary substrates.