Property Summary

NCBI Gene PubMed Count 74
PubMed Score 60.19
PubTator Score 99.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
ovarian cancer 8491 1.4e-05
psoriasis 6685 1.4e-05
Breast cancer 3098 2.1e-03
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.2e-02
gastric carcinoma 832 4.1e-02
Disease Target Count Z-score Confidence
Prostate cancer 172 3.997 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -2.500 1.2e-02
Breast cancer -1.300 2.1e-03
gastric carcinoma -3.700 4.1e-02
ovarian cancer 1.400 1.4e-05
psoriasis -1.500 1.4e-05

Gene RIF (58)

PMID Text
26385605 miR-376c is inversely linked to UGT2B15 and UGT2B17 expression in high-grade prostate cancer and metastasis.UGT2B15 and UGT2B17 genes are direct targets of miR-376c and thus may influence steroid metabolism during prostate cancer progression.
26238215 CYP3A4, CYP3A7, UGT2B11 and UGT2B15 genes are significantly downregulated in melanosis coli.
26176234 This descriptive study examines correlations between concentrations of tamoxifen's glucuronide metabolites and genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 in 132 patients with estrogen receptor-positive breast cancer under treatment with tamoxifen
26163549 Expression of UGT2B15 and UGT2B17 is negatively regulated by the binding of miR-376c.
25795461 Data suggest that both 17beta-estradiol and the antiestrogen 4-OHTAM (4-hydroxytamoxifen, a metabolite of tamoxifen and substrate of UGT2B15) up-regulate UGT2B15 in breast cancer cells via the same estrogen receptor alpha- (ERa-)signaling pathway.
24980262 Hepatic UGT2B15 protein onset begins in late gestation; however, the greatest rate of change occurs during the first few weeks after birth.
24822274 A haplotype in UGT2B15 containing a functional variant (rs4148269, K523T) and an intronic SNP (rs6837575) was found to affect rectal cancer risk overall (OR = 2.57, 95% CI = 1.21-5.04) and in females (OR = 3.08, 95% CI = 1.08-8.74).
24267955 Novel associations between UGT2B15 and UGT2B17 single nucleotide polymorphism variants and prostate cancer risk.
24214217 UGT2B15 genotype is a major determinant for differences in fasting plasma glucose and HbA1c response to sipoglitazar treatment between Type 2 Diabetes mellitus patients, due to related differences in drug exposure.
24121496 UGT2B15 is a possible target for androgen deprivation therapy of prostate cancer.
23951298 In the tamoxifen-treated subgroup poor prognosis was related to the combined presence of ESR1 PvuII wt/wt and UGT2B15 wt/wt or wt/*2 genotype.
23404680 Report the influence of functionally relevant polymorphic UGT2B15, the enzyme mediating bisphenol A metabolism using kinetic based modelling.
23223495 Report UGT2B15 expression in fetal/adult tissues.
22960998 Sipoglitazar clearance is substantially modified by UGT2B15 enzyme variants, with higher exposure observed in the UGT2B15*2/*2 genotype group.
22532564 Data indicates that 2B15 requires regulated phosphorylation by both PKCalpha and Src, which is consistent with the complexity of synthesis and metabolism of its major substrate, DHT.
22170718 The study revealed that UGT2B15 and UGT2B17 are differentially regulated during prostate cancer progression.
21666065 For UGT2B15, the percentage of APAPG decreased (P < 0.0001) and that of APAP sulfate increased (P = 0.002) in an allelic dose-dependent manner across genotypes from *1/*1 to *2/*2.
21404072 The D85Y substitution in UGT2B15 decreases enzymatic function, and the polymorphic alleles of UGT2B15 are closely associated with variations in the metabolism and toxicity of bisphenol A.
21365123 Data show that steroidogenic enzymes (AKR1C3, HSD17B2, UGT2B15 and UGT2B17) and stem/progenitor cell markers CK5 and ABCG2 were upregulated in castration resistant prostate cancer.
20736324 regulation of the UGT2B15 and UGT2B17 genes by FOXA1 may have an important role in the maintenance of androgen homeostasis within prostate cancer cells.
20142249 Observational study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19916996 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19847790 SNPs in strong linkage disequilibrium with G253T regulate UGT2B15 expression in liver.
19572376 UGT2B15 functional polymorphism along with Copy-number variations
19487245 Estrogen receptor alpha, fos-related antigen-2, and c-jun coordinately regulate human UGT2B15 expression in response to 17beta-estradiol in MCF-7 cells.
19343046 Observational study of gene-disease association. (HuGE Navigator)
18496127 Observational study of gene-disease association. (HuGE Navigator)
18302198 UGT2B15 ia a primary androgen-regulated genes and androgen receptor is required for basal expression and androgen-regulated expression.
18281521 Vitamin D receptor activator calcitriol as a negative regulator of the UGT2B15- and UGT2B17-dependent inactivation of androgens in prostate cancer LNCaP cells.
18161889 Observational study of gene-disease association. (HuGE Navigator)
17988216 Androsterone reduces the glucuronidation of androgens catalysed by UGT2B15 and UGT2B17 in a prostate tumor cell line.
17848572 UGT2B15 and -B17 are critical enzymes for the local inactivation of androgens and that glucuronidation is a major determinant of androgen action in prostate cells
17698910 Observational study of gene-disease association. (HuGE Navigator)
17687269 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17576806 5-(4'-Hydroxyphenyl)-5-phenylhydantoin O-glucuronide formation in human liver microsomes is catalyzed by UGT1A1, UGT1A9, and UGT2B15 in a stereoselective manner
17507624 Observational study of gene-disease association. (HuGE Navigator)
17244352 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16859836 Observational study of gene-disease association. (HuGE Navigator)
16690804 estrogen-induced up-regulation of UGT2B15 might have a significant moderating effect on estrogen and androgen concentrations, thereby reducing their signaling in breast cancer cells
16513443 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15961980 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15952058 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15952058 Tamoxifen-treated patients with UGT2B15 high activity genotypes had increased risk of recurrence
15666817 In human prostate, UGT2B15 and UGT2B17 genes have complementary roles and are expressed in cells where their specific substrates are synthesized.
15618667 Observational study of genotype prevalence. (HuGE Navigator)
15318931 Observational study of gene-disease association. (HuGE Navigator)
15126881 Observational study of gene-disease association. (HuGE Navigator)
15065092 Observational study of gene-disease association. (HuGE Navigator)
15044558 Observational study of gene-disease association. (HuGE Navigator)
15044558 Gender and UGT2B15 D85Y genotype are identified as major determinants of S-oxazepam glucuronidation by human liver and may explain in part polymorphic oxazepam glucuronidation by human subjects.
12880121 Although D85 and Y85 appear to be common variants, we cannot exclude the possibility that the UGT2B15 gene represents a minor modifying locus.
12646996 The alteration of UGT2B15 expression in LNCaP-SF cells is proposed as a biological characteristic involved in the growth of hormone-refractory prostate cancer.
12386133 S-oxazepam is stereoselectively glucuronidated by UGT2B15, whereas R-oxazepam is glucuronidated by multiple UGT isoforms. Allelic variation associated with the UGT2B15 gene may explain polymorphic S-oxazepam glucuronidation in humans.
12376738 Single-nucleotide polymorphisms (SNPs) were found in UGT2B15 gene
12010866 UGT2B15 polymorphism cannot be considered as a susceptibility marker for prostate cancer, but it involoved in glucuronidation of numerous phytochemicals. This polymorphism could contribute to interindividual variability in chemopreventive effects.
11129427 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSS      1 - 70
AIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMK     71 - 140
LQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFME    141 - 210
RIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGG    211 - 280
LHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGS    281 - 350
NTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRT    351 - 420
MSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYH    421 - 490
SLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD                                  491 - 530
//

Text Mined References (77)

PMID Year Title
26385605 2016 Epigenetic regulation of steroid inactivating UDP-glucuronosyltransferases by microRNAs in prostate cancer.
26238215 2015 Histopathology of melanosis coli and determination of its associated genes by comparative analysis of expression microarrays.
26176234 2015 Impacts of the Glucuronidase Genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 on Tamoxifen Metabolism in Breast Cancer Patients.
26163549 2015 Regulation of Human UGT2B15 and UGT2B17 by miR-376c in Prostate Cancer Cell Lines.
25795461 2015 Induction of UDP-glucuronosyltransferase 2B15 gene expression by the major active metabolites of tamoxifen, 4-hydroxytamoxifen and endoxifen, in breast cancer cells.
24980262 2014 Human hepatic UGT2B15 developmental expression.
24822274 2014 The effect of UGT1A and UGT2B polymorphisms on colorectal cancer risk: haplotype associations and gene–environment interactions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24267955 2013 Novel associations of UDP-glucuronosyltransferase 2B gene variants with prostate cancer risk in a multiethnic study.
24214217 2014 A model-based approach to analyze the influence of UGT2B15 polymorphism driven pharmacokinetic differences on the pharmacodynamic response of the PPAR agonist sipoglitazar.
24121496 2013 Androgen glucuronidation: an unexpected target for androgen deprivation therapy, with prognosis and diagnostic implications.
23951298 2013 Prognostic significance of ESR1 amplification and ESR1 PvuII, CYP2C19*2, UGT2B15*2 polymorphisms in breast cancer patients.
23404680 2013 Functional UDP-glucuronyltransferase 2B15 polymorphism and bisphenol A concentrations in blood: results from physiologically based kinetic modelling.
23223495 2013 Tissue distribution and relative gene expression of UDP-glucuronosyltransferases (2B7, 2B15, 2B17) in the human fetus.
22960998 2013 The effect of genetic polymorphisms in UGT2B15 on the pharmacokinetic profile of sipoglitazar, a novel anti-diabetic agent.
22829776 2012 A genome-wide association meta-analysis of circulating sex hormone-binding globulin reveals multiple Loci implicated in sex steroid hormone regulation.
22579593 2012 Simultaneous evaluation of six human glucuronidation activities in liver microsomes using liquid chromatography-tandem mass spectrometry.
22532564 2012 Protein kinase C? and Src kinase support human prostate-distributed dihydrotestosterone-metabolizing UDP-glucuronosyltransferase 2B15 activity.
22170718 2012 Differential expression of the androgen-conjugating UGT2B15 and UGT2B17 enzymes in prostate tumor cells during cancer progression.
21666065 2011 UGT1A6 and UGT2B15 polymorphisms and acetaminophen conjugation in response to a randomized, controlled diet of select fruits and vegetables.
21404072 2011 Effect of UDP-glucuronosyltransferase 2B15 polymorphism on bisphenol A glucuronidation.
21365123 2011 Steroidogenic enzymes and stem cell markers are upregulated during androgen deprivation in prostate cancer.
20736324 2010 Forkhead box protein A1 regulates UDP-glucuronosyltransferase 2B15 gene transcription in LNCaP prostate cancer cells.
20308471 2010 Role of UDP-glucuronosyltransferase isoforms in 13-cis retinoic acid metabolism in humans.
20142249 2010 Associations between polymorphisms in glucuronidation and sulfation enzymes and mammographic breast density in premenopausal women in the United States.
20056724 2010 Phase II metabolism of hesperetin by individual UDP-glucuronosyltransferases and sulfotransferases and rat and human tissue samples.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19916996 2009 Evidence for oxazepam as an in vivo probe of UGT2B15: oxazepam clearance is reduced by UGT2B15 D85Y polymorphism but unaffected by UGT2B17 deletion.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19847790 2010 Allelic imbalance (AI) identifies novel tissue-specific cis-regulatory variation for human UGT2B15.
19572376 2009 Copy-number variations (CNVs) of the human sex steroid metabolizing genes UGT2B17 and UGT2B28 and their associations with a UGT2B15 functional polymorphism.
19487245 2009 Estrogen receptor alpha, fos-related antigen-2, and c-Jun coordinately regulate human UDP glucuronosyltransferase 2B15 and 2B17 expression in response to 17beta-estradiol in MCF-7 cells.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18496127 2008 Genetic aspects of epitestosterone formation and androgen disposition: influence of polymorphisms in CYP17 and UGT2B enzymes.
18302198 2008 Androgen receptor mediates the expression of UDP-glucuronosyltransferase 2 B15 and B17 genes.
18281521 2008 Calcitrol (1alpha,25-dihydroxyvitamin D3) inhibits androgen glucuronidation in prostate cancer cells.
18161889 2008 Detoxification enzyme polymorphisms are not involved in duodenal adenomatosis in familial adenomatous polyposis.
17988216 2008 Activators of the farnesoid X receptor negatively regulate androgen glucuronidation in human prostate cancer LNCAP cells.
17848572 2007 UDP-glucuronosyltransferase 2B15 (UGT2B15) and UGT2B17 enzymes are major determinants of the androgen response in prostate cancer LNCaP cells.
17698910 2007 The uridine diphosphate glucuronosyltransferase 2B15 D85Y and 2B17 deletion polymorphisms predict the glucuronidation pattern of androgens and fat mass in men.
17687269 2008 Pharmacokinetic and pharmacodynamic interaction of lorazepam and valproic acid in relation to UGT2B7 genetic polymorphism in healthy subjects.
17576806 2007 Stereoselective glucuronidation of 5-(4'-hydroxyphenyl)-5-phenylhydantoin by human UDP-glucuronosyltransferase (UGT) 1A1, UGT1A9, and UGT2B15: effects of UGT-UGT interactions.
17507624 2007 Evaluation of genetic variations in the androgen and estrogen metabolic pathways as risk factors for sporadic and familial prostate cancer.
17244352 2007 Genetic variants of CYP3A5, CYP2D6, SULT1A1, UGT2B15 and tamoxifen response in postmenopausal patients with breast cancer.
16859836 2006 Association of the polymorphisms of genes involved in androgen metabolism and signaling pathways with familial prostate cancer risk in a Japanese population.
16690804 2006 Estrogen regulation of the glucuronidation enzyme UGT2B15 in estrogen receptor-positive breast cancer cells.
16513443 2006 Organic anion transporting polypeptide 1B1 activity classified by SLCO1B1 genotype influences atrasentan pharmacokinetics.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15961980 2005 Effect of the UGT2B15 genotype on the pharmacokinetics, pharmacodynamics, and drug interactions of intravenous lorazepam in healthy volunteers.
15952058 2005 Association of genetic variation in tamoxifen-metabolizing enzymes with overall survival and recurrence of disease in breast cancer patients.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15666817 2004 Cellular specific expression of the androgen-conjugating enzymes UGT2B15 and UGT2B17 in the human prostate epithelium.
15618667 2002 A major genotype in UDP-glucuronosyltransferase 2B15.
15318931 2004 UDP-glucuronosyltransferase and sulfotransferase polymorphisms, sex hormone concentrations, and tumor receptor status in breast cancer patients.
15126881 2004 Asp85tyr polymorphism in the udp-glucuronosyltransferase (UGT) 2B15 gene and the risk of prostate cancer.
15065092 2004 Prostate cancer and polymorphism D85Y in gene for dihydrotestosterone degrading enzyme UGT2B15: Frequency of DD homozygotes increases with Gleason Score.
15044558 2004 UDP-glucuronosyltransferase (UGT) 2B15 pharmacogenetics: UGT2B15 D85Y genotype and gender are major determinants of oxazepam glucuronidation by human liver.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880121 2003 Frequencies of the D85 and Y85 variants of UGT2B15 in children and adolescent girls with hyperandrogenism.
12646996 2003 Androgen-independent growth in LNCaP cell lines and steroid uridine diphosphate-glucuronosyltransferase expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12386133 2002 Stereoselective conjugation of oxazepam by human UDP-glucuronosyltransferases (UGTs): S-oxazepam is glucuronidated by UGT2B15, while R-oxazepam is glucuronidated by UGT2B7 and UGT1A9.
12376738 2002 Catalog of 86 single-nucleotide polymorphisms (SNPs) in three uridine diphosphate glycosyltransferase genes: UGT2A1, UGT2B15, and UGT8.
12010866 2002 A polymorphism in the UDP-Glucuronosyltransferase 2B15 gene (D85Y) is not associated with prostate cancer risk.
11129427 2000 An allele-specific polymerase chain reaction method for the determination of the D85Y polymorphism in the human UDP-glucuronosyltransferase 2B15 gene in a case-control study of prostate cancer.
10748067 2000 Polymorphic gene regulation and interindividual variation of UDP-glucuronosyltransferase activity in human small intestine.
10468930 1999 Expression of the androgen metabolizing enzyme UGT2B15 in adipose tissue and relative expression measurement using a competitive RT-PCR method.
10024527 1999 Regulation and function of family 1 and family 2 UDP-glucuronosyltransferase genes (UGT1A, UGT2B) in human oesophagus.
9295060 1997 Isolation and characterization of UGT2B15(Y85): a UDP-glucuronosyltransferase encoded by a polymorphic gene.
9202245 1997 Differential regulation of two uridine diphospho-glucuronosyltransferases, UGT2B15 and UGT2B17, in human prostate LNCaP cells.
8399210 1993 Characterization of a cloned human dihydrotestosterone/androstanediol UDP-glucuronosyltransferase and its comparison to other steroid isoforms.
7835904 1994 Isolation of a human YAC contig encompassing a cluster of UGT2 genes and its regional localization to chromosome 4q13.
7835232 Stable expression of a human liver UDP-glucuronosyltransferase (UGT2B15) with activity toward steroid and xenobiotic substrates.
7574722 1995 Cloning and expression of a rat liver phenobarbital-inducible UDP-glucuronosyltransferase (2B12) with specificity for monoterpenoid alcohols.
3100939 1987 Isolation and purification of two human liver UDP-glucuronosyltransferases.
2116769 1990 Characterization and primary sequence of a human hepatic microsomal estriol UDPglucuronosyltransferase.