Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.07
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -1.100 8.5e-04
intraductal papillary-mucinous carcinoma... -3.400 3.0e-03
nephrosclerosis -1.073 2.8e-02
non primary Sjogren syndrome sicca -1.600 2.0e-02
ulcerative colitis -5.400 1.4e-08

Gene RIF (5)

AA Sequence

MRSDKSALVFLLLQLFCVGCGFCGKVLVWPCDMSHWLNVKVILEELIVRGHEVTVLTHSKPSLIDYRKPS      1 - 70
ALKFEVVHMPQDRTEENEIFVDLALNVLPGLSTWQSVIKLNDFFVEIRGTLKMMCESFIYNQTLMKKLQE     71 - 140
TNYDVMLIDPVIPCGDLMAELLAVPFVLTLRISVGGNMERSCGKLPAPLSYVPVPMTGLTDRMTFLERVK    141 - 210
NSMLSVLFHFWIQDYDYHFWEEFYSKALGRPTTLCETVGKAEIWLIRTYWDFEFPQPYQPNFEFVGGLHC    211 - 280
KPAKALPKEMENFVQSSGEDGIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR    281 - 350
LYDWIPQNDLLGHPKTKAFITHGGMNGIYEAIYHGVPMVGVPIFGDQLDNIAHMKAKGAAVEINFKTMTS    351 - 420
EDLLRALRTVITDSSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHDLTWFQHYSID    421 - 490
VIGFLLACVATAIFLFTKCFLFSCQKFNKTRKIEKRE                                     491 - 527
//

Text Mined References (11)

PMID Year Title