1. Home
  2. Targets
  3. UDP-glucuronosyltransferase 1-9

Tbio UDP-glucuronosyltransferase 1-9

UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform has specificity for phenols. Isoform 2 lacks transferase activity but acts as a negative regulator of isoform 1.

This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenols. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 160
PubMed Score 144.67
PubTator Score 232.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
psoriasis 6685 7.4e-23
Disease Target Count Z-score Confidence
Anemia 252 0.0 2.0
Attention deficit hyperactivity disorder 156 0.0 1.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.900 7.4e-23

Synonym

Accession O60656 B8K285 P36509 Q9HAX0 UDPGT 1-9
Symbols LUGP4
UDPGT
UGT1I
HLUGP4
UGT-1I
UGT1-9
UGT1.9
UGT1AI
UGT1-09
UGT1A9S
UDPGT 1-9

Gene

UGT1A9

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 UniProt Keyword (13)

See all...

 GO Function (6)

 GO Component (4)

 GO Process (10)

 Compartment GO Term (32)

See all...

 GWAS Trait (7)

 HCA RNA Cell Line (6)

 CSPA Cell Line (3)

Pathway (41)

See all...

Protein-protein Interaction (3)

UGT1A10   UGT1A7   ESYT1  

Gene RIF (111)

PMID Text
26407805 UGT1A9 contributes to the in-vitro glucuronidation of arctigenin in liver microsomes.
26247833 the in vitro glucuronidation of raloxifene in humans and monkeys was examined using liver and intestinal microsomes and recombinant UGT enzymes (UGT1A1, UGT1A8 and UGT1A9).
26010150 in tumor liver microsomes from HCC patients, either V(max) (maximum reaction rate, R(max) for UGT1A1) or clearance rates (V(max)/K(m), Clint) of UGT1A, UGT1A1, UGT1A4, UGT1A9 and UGT2B7 were lower than those in the adjacent normal liver microsomes
25547628 UGT1A10 exhibited somewhat higher BPA glucuronidation activity than UGT1A9, but it was lower than UGT2A1 and UGT2B15. 4.
25446781 We observed statistically significant associations between SNP and Drug-induced liver injury at both allele and genotype levels of of UGT1A9 promoter
25380893 Significantly lower estimated glomerular filtration rate of the renal allograft in UGT1A9 c.98C carriers did not translate into decreased allograft survival.
24470170 Suggest that the enzymatic properties of UGT1A9 are considerably different between humans and cynomolgus monkeys, although humUGT1A9 and monUGT1A9 were highly conserved at the amino acid level.
24453052 Data shows that UGT1A9*22 allele was significantly less frequent in the Uzbek population compared to the Japanese.
24092055 In HeLa cells overexpressing UGT1A9 there was an increase in catalysis and production of luteolin glucuronides.
24025985 UGT1A9 is the major isoform responsible for the glucuronidations of fraxetin in liver microsomes.
23842475 the UGT1A9 proximal promoter was assumed to change into the non-active form from the original sequence, and this might be one of the reasons for the tissue-specific expression of UGT1A9.
23789755 The presence of UGT1A1*28, UGT1A7*3, UGT1A9*22 genotypes decreases SN-38 clearance between 20 and 36%
23721685 Genetic polymorphisms of UGT1A8, UGT1A9 and HNF-1alpha and gastrointestinal symptoms in renal transplant recipients taking mycophenolic acid.
23700788 none of the SNPs in UGT1A9 were present in our study population
23527766 UGT1A9 is a major contributor for (R) and (S) glucuronidation in the human liver and kidney.
23488780 Data suggest that the substrate specificity of UGT1A9 includes the antiviral drug arbidol; UGT1A9 appears to be the major UGT isoform involved in the formation of arbidol glucuronides by liver microsomes.
23402418 determined the kinetics of efflux of 13 flavonoid glucuronides using the newly developed HeLa-UGT1A9 cells and correlated them with kinetic parameters derived using expressed UGT1A9
23230132 UGT1A9 and 2B7 are the main enzymes involved in ethanol glucuronidation. In addition, our results suggest that cannabinol and cannabidiol could significantly alter ethanol glucuronidation.
23184343 Alleles UGT1A9*4 and UGT1A9*5 were not present in any of the subjects of Polish population.
23131697 genetic association studies in pediatric population in United States: Data suggest that combined SNPs in UGT1A9, UGT2B7, and MRP2 are important in pharmacokinetics/biotransformation of prodrug mycophenolate mofetil in kidney transplant recipients.
22912756 increased cumulated drug exposure and UGT1A9 polymorphism (rs17868320) identified patients at high risk for early sorafenib-induced severe toxicity
22527346 In Parkinson's disease patients UDP-glucuronosyltransferase 1A9 genotypes are associated with adverse reactions to to catechol-O-methyltransferase inhibitors
22492655 Expression of UGT1A9 correlated with age only in children younger than 1 year (Spearman r = 0.70).
22307138 Study indicates that genotype status of UGT1A1, UGT1A9, and ABCC2 and serum bilirubin concentration increases reflect abnormally high AUC in patients treated with sorafenib.
22302521 Report molecular models that can predict phenol substrate selectivity and in vitro clearance of UGT1A9.
22210424 transplanted kidney function may be affected in patients carrying UGT1A9 98C allele and receiving mycophenolate mophetil
22184458 Investigation of morinidazole glucuronidation using human liver microsomes (HLMs) and 12 recombinant UDP glucuronosyltransferases (UGTs) indicated that this biotransformation was mainly catalyzed by UGT1A9.
22031623 Data suggest that darexaban glucuronidation in liver microsomes is mainly catalyzed by UGT1A9; studies include kinetics of recombinant UGT proteins, liver microsomes, and jejunal microsomes (and UGT isoform-specific inhibitors/substrates).
21856742 The presence of BSA during the glucuronidation reaction leads to a large increase in the V(max) value of UGT1A9, in addition to lowering its K(m) value.
21856293 A significantly stereoselective difference on the glucuronidation of rac-FPF was seen between the two variants compared with the wild type of UGT1A9.
21072184 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628391 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20565459 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20297805 The results also indicated that UGT1A1, UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2B7 are the most important six UGT isoforms for metabolizing the three dihydroxyflavones and seven monohydroxyflavones.
20214802 Observational study of gene-disease association. (HuGE Navigator)
20147615 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20089735 Further mutagenesis and activity assays suggested that Phe117 of UGT1A9 participates in 1-naphthol binding
20007669 Data point to UGT1A9 as main UGT isoform in liver microsomes metabolizing psilocin (a hallucinogenic indole alkaloid); kinetic studies are included.
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19951703 N-glycosylation has an important role in the folding of UGT1A9.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19881262 In this study, we sequenced the promoter and exon 1 regions of the UGT1A9 gene in 93 Thai individuals and identified 7 genetic polymorphisms
19881262 Observational study of genotype prevalence. (HuGE Navigator)
19715905 Carriers of single nucleotide polymorphisms in this protein's promotor region show a greater incidence of gastrointestinal side effects and lower exposure to mycophenolic acid.
19715905 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19644937 analysis of stereoselective metabolism of propranolol glucuronidation by human UDP-glucuronosyltransferases 2B7 and 1A9
19571435 Root mean square fluctuation analyses and a dynamical cross correlation map revealed that Lys91, Ala92, Tyr106, Gly111, Tyr113, Asp115, Leu219, His221, Arg222 and Glu241 were responsible for the thermal stability
19494809 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19364970 UGT1A variants additional to UGT1A1*28 might improve the prediction of the outcome of colorectal cancer patients treated with FOLFIRI.
19364970 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19349540 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19225446 Observational study of gene-disease association. (HuGE Navigator)
19204906 Observational study of genotype prevalence. (HuGE Navigator)
19082692 UGT1A9 contributes to glucuronidation of gaboxadol in kidney and liver.
18981166 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18946804 the effect of UGT1A9 polymorphism on the pharmacokinetics of mycophenolic acid (MPA) and its metabolites phenolic glucuronide (MPAG) and acyl glucuronide (AcMPAG) in Chinese renal transplant
18946804 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18816295 Observational study of genotype prevalence. (HuGE Navigator)
18695635 In a study of Japanese renal transplant recipients, there are no significant differences in the area under the plasma concentration-time curve ratio of mycophenolic acid glucuronide/MPA between UGT1A9 I399C/T genotypes.
18675828 investigated whether colon cancer was associated with genetic variations in UGT1A1 and UGT1A9 genes and we determined if those variations modify the association between colon cancer and dietary HCA and PAH exposure
18675828 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18602884 amino acid positions 69-132 of UGT1A9 are responsible for chemoselectivity for phenylbutazone and affinity to substrates such as phenylbutazone and 7-hydroxy-(4-trifluoromethyl)coumarin
18597651 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18568343 The effect of UGT1A8 and UGT1A9 variants on mycophenolic acid metabolism appears to be modified by concomitant calcineurin inhibitor therapy.
18568343 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18502788 H37 is not critical in N-glucuronidation, but is so in O-glucuronidation. The V(max) of the H37A mutant was much less affected in N- than O-glucuronidation, while the reverse was true for the Asp mutations, particularly D143A.
18430559 UGT1A1 and UGT1A9 activity in human liver are affected by soyabean isoflavones genistein and daidzein
18279479 Polymorphisms of UGT1A9 did not show any effect on the pharmacokinetics of MPA and MPAG.
18221820 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18052087 UGT1A7, UGT1A8, and UGT1A9 were mainly responsible for formation of prunetin-5- O-glucuronide; UGT1A1, UGT1A8, and UGT1A10 were mainly responsible for formation of prunetin-4'- O-glucuronide; thermostability of microsomes was isoform- and organ-dependent
17965524 HNF1alpha and HNF4alpha are the factors involved in the interindividual variability of liver UGT1A6 and UGT1A9 mRNA expression.
17924828 Significant impact of C-440T/T-331C SNPs in the promoter region of the UGT1A9 gene on mycophenoic acid pharmacokinetics in renal allograft recipients.
17924828 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17761781 Observational study of gene-disease association. (HuGE Navigator)
17761781 Common polymorphisms do not explain interindividual variation in hepatic UGT1A9 activity/mRNA expression and are in complete linkage disequilibrium in donor liver samples.
17700594 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17576806 5-(4'-Hydroxyphenyl)-5-phenylhydantoin O-glucuronide formation in human liver microsomes is catalyzed by UGT1A1, UGT1A9, and UGT2B15 in a stereoselective manner
17558305 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17529886 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17440429 Provide evidence for HNF1alpha as a determinant of UGT1A9 mRNA expression, but suggest a role for multiple transcription factors.
17406868 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17406868 Genetic linkage of UGT1A7 and UGT1A9 polymorphisms to UGT1A1*6, related to reduced catalytic and transcriptional activities of UGTs, is associated with the decreased glucuronosyltransferase activity for SN-38 in Japanese
17339869 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17264800 the human UDP-glucuronosyltransferase 1A9 promoter can indeed be upregulated by human hepatocyte nuclear factor 4alpha in vitro
17115150 Observational study of genotype prevalence. (HuGE Navigator)
17072959 Observational study of gene-disease association. (HuGE Navigator)
16636344 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16397224 Observational study of genotype prevalence. (HuGE Navigator)
16344532 UGT1A9 poor metabolizer genotype(s) may be a predisposing factor for COMT inhibitor-induced hepatotoxicity.
16198654 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15864130 Observational study of genotype prevalence. (HuGE Navigator)
15855726 Observational study of gene-disease association. (HuGE Navigator)
15709193 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15470081 HNF4alpha as a major factor for the control of UGT1A9 hepatic expression.
15370961 stereoselectivity for etodolac
15286088 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15284532 Observational study of gene-disease association. (HuGE Navigator)
15258099 Study provides preliminary evidence that genetic factors, especially in hepatic UGT1A9, may contribute to the variability of mycophenolic acid pharmacokinetics observed in transplant patients.
15115919 Observational study of genotype prevalence. (HuGE Navigator)
15115919 mutant allele with one base insertion in the promoter region of the UGT1A9 gene would alter the level of enzyme expression and the metabolism of those drugs that are substrates of UGT1A9
15057901 Observational study of gene-disease association. (HuGE Navigator)
14660172 a significant role for UGT1A9 and 2B7 in the catalysis of almokalant glucuronidation
14521259 Observational study of gene-disease association. (HuGE Navigator)
12847094 UGT1A8, 1A9, and 1A10 genes are differentially regulated through an initiator element in their 5'-flanking regions
12623074 These results demonstrate for the first time glucuronidation of catechols by gastric and intestinal microsomal UGTs and three human recombinant UGT isoforms.Recombinant human UGT1A6, 1A9, and 2B7 effectively catalyzed catechol glucuronidation
12582161 1A9 enzyme is a peroxisome proliferator-activated receptor alpha and gamma target gene
11854913 sequence of the cDNA segment cloned, 1666 bp in length. The recombinant constructed, pREP9-UGT1A9, contains the entire coding region, along with 18 bp of the 5' and 55 bp of the 3' untranslated region of theUGT1A9 cDNA.
11677206 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence 

MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSL      1 - 70
NCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKES     71 - 140
SFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNH    141 - 210
IMHLEEHLLCHRFFKNALEIASEILQTPVTEYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQG    211 - 280
KPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK    281 - 350
WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL    351 - 420
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG    421 - 490
FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                                  491 - 530
//

Text Mined References (163)

PMID Year Title
26407805 2015 Identification and characterization of human UDP-glucuronosyltransferases responsible for the in-vitro glucuronidation of arctigenin.
26247833 2016 Raloxifene glucuronidation in liver and intestinal microsomes of humans and monkeys: contribution of UGT1A1, UGT1A8 and UGT1A9.
26010150 2015 Drug-Metabolizing Activity, Protein and Gene Expression of UDP-Glucuronosyltransferases Are Significantly Altered in Hepatocellular Carcinoma Patients.
25547628 2015 Differences in the glucuronidation of bisphenols F and S between two homologous human UGT enzymes, 1A9 and 1A10.
25446781 2015 Association study of UGT1A9 promoter polymorphisms with DILI based on systematically regional variation screen in Chinese population.
25380893 2014 Recipient uridine 5'-diphospho-glucuronosyltransferase UGT1A9 c.98T>C variant determines transplanted kidney filtration rate.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24470170 2014 Functional characterization of cynomolgus monkey UDP-glucuronosyltransferase 1A9.
24453052 2014 Differences in UGT1A1, UGT1A7, and UGT1A9 polymorphisms between Uzbek and Japanese populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24092055 2014 Breast cancer resistance protein-mediated efflux of luteolin glucuronides in HeLa cells overexpressing UDP-glucuronosyltransferase 1A9.
24025985 2014 Identification and characterization of human UDP-glucuronosyltransferases responsible for the glucuronidation of fraxetin.
23842475 2014 Comparative studies of human UDP-glucuronosyltransferase 1A8 and 1A9 proximal promoters using single base substitutions.
23789755 [Influence of genetic polymorphisms in UGT1A1, UGT1A7 and UGT1A9 on the pharmacokynetics of irinotecan, SN-38 and SN-38G].
23721685 2013 Genetic polymorphisms of UGT1A8, UGT1A9 and HNF-1? and gastrointestinal symptoms in renal transplant recipients taking mycophenolic acid.
23700788 2013 Genetic polymorphisms of UGT1A8, UGT1A9, UGT2B7 and ABCC2 in Chinese renal transplant recipients and a comparison with other ethnic populations.
23642732 2013 Association of SNPs in the UGT1A gene cluster with total bilirubin and mortality in the Diabetes Heart Study.
23527766 2013 Enantiomer selective glucuronidation of the non-steroidal pure anti-androgen bicalutamide by human liver and kidney: role of the human UDP-glucuronosyltransferase (UGT)1A9 enzyme.
23488780 2013 Glucuronidation of the broad-spectrum antiviral drug arbidol by UGT isoforms.
23402418 2013 Revolving door action of breast cancer resistance protein (BCRP) facilitates or controls the efflux of flavone glucuronides from UGT1A9-overexpressing HeLa cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23371916 2013 A genome-wide association study for serum bilirubin levels and gene-environment interaction in a Chinese population.
23281178 2013 A genome-wide assessment of variability in human serum metabolism.
23230132 2013 Involvement of UDP-glucuronosyltransferases UGT1A9 and UGT2B7 in ethanol glucuronidation, and interactions with common drugs of abuse.
23184343 2013 Genotype and allele frequencies of polymorphic UGT1A9 in the Polish population.
23131697 2012 UGT1A9, UGT2B7, and MRP2 genotypes can predict mycophenolic acid pharmacokinetic variability in pediatric kidney transplant recipients.
22912756 2012 Early sorafenib-induced toxicity is associated with drug exposure and UGTIA9 genetic polymorphism in patients with solid tumors: a preliminary study.
22579593 2012 Simultaneous evaluation of six human glucuronidation activities in liver microsomes using liquid chromatography-tandem mass spectrometry.
22558097 2012 A genome-wide association study of total bilirubin and cholelithiasis risk in sickle cell anemia.
22527346 2012 Association of UDP-glucuronosyltransferase 1A9 polymorphisms with adverse reactions to catechol-O-methyltransferase inhibitors in Parkinson's disease patients.
22511988 2012 A genome-wide association study identifies UGT1A1 as a regulator of serum cell-free DNA in young adults: The Cardiovascular Risk in Young Finns Study.
22492655 2012 Neonatal development of hepatic UGT1A9: implications of pediatric pharmacokinetics.
22307138 2012 Sorafenib is an inhibitor of UGT1A1 but is metabolized by UGT1A9: implications of genetic variants on pharmacokinetics and hyperbilirubinemia.
22302521 2012 Accurate prediction of glucuronidation of structurally diverse phenolics by human UGT1A9 using combined experimental and in silico approaches.
22210424 Association of UDP-glucuronosyltransferase 1A9 (UGT1A9) gene polymorphism with kidney allograft function.
22184458 2012 Metabolism and pharmacokinetics of morinidazole in humans: identification of diastereoisomeric morpholine N+-glucuronides catalyzed by UDP glucuronosyltransferase 1A9.
22085899 2012 UGT1A1 is a major locus influencing bilirubin levels in African Americans.
22031623 2012 Identification of UDP-glucuronosyltransferases responsible for the glucuronidation of darexaban, an oral factor Xa inhibitor, in human liver and intestine.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21856742 2011 Bovine serum albumin decreases Km values of human UDP-glucuronosyltransferases 1A9 and 2B7 and increases Vmax values of UGT1A9.
21856293 2011 Characterizing the effect of UDP-glucuronosyltransferase (UGT) 2B7 and UGT1A9 genetic polymorphisms on enantioselective glucuronidation of flurbiprofen.
21646302 2011 Mayo Genome Consortia: a genotype-phenotype resource for genome-wide association studies with an application to the analysis of circulating bilirubin levels.
21072184 2010 Flavopiridol pharmacogenetics: clinical and functional evidence for the role of SLCO1B1/OATP1B1 in flavopiridol disposition.
20732626 2010 Family-based genome-wide association scan of attention-deficit/hyperactivity disorder.
20639394 2010 Genome-wide association of serum bilirubin levels in Korean population.
20628391 2010 UGT1A and TYMS genetic variants predict toxicity and response of colorectal cancer patients treated with first-line irinotecan and fluorouracil combination therapy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20610558 2010 Alternatively spliced products of the UGT1A gene interact with the enzymatically active proteins to inhibit glucuronosyltransferase activity in vitro.
20565459 2010 Risk of diarrhoea in a long-term cohort of renal transplant patients given mycophenolate mofetil: the significant role of the UGT1A8 2 variant allele.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20308471 2010 Role of UDP-glucuronosyltransferase isoforms in 13-cis retinoic acid metabolism in humans.
20297805 2010 Use of glucuronidation fingerprinting to describe and predict mono- and dihydroxyflavone metabolism by recombinant UGT isoforms and human intestinal and liver microsomes.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
20147615 2010 Population pharmacokinetics and pharmacogenetics of mycophenolic acid following administration of mycophenolate mofetil in de novo pediatric renal-transplant patients.
20089735 2010 How many and which amino acids are responsible for the large activity differences between the highly homologous UDP-glucuronosyltransferases (UGT) 1A9 and UGT1A10?
20056724 2010 Phase II metabolism of hesperetin by individual UDP-glucuronosyltransferases and sulfotransferases and rat and human tissue samples.
20007669 2010 Glucuronidation of psilocin and 4-hydroxyindole by the human UDP-glucuronosyltransferases.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19951703 2010 N-Glycosylation plays a role in protein folding of human UGT1A9.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19881262 2009 Three novel single nucleotide polymorphisms of UGT1A9 in a Thai population.
19715905 The prevalence of uridine diphosphate-glucuronosyltransferase 1A9 (UGT1A9) gene promoter region single-nucleotide polymorphisms T-275A and C-2152T and its influence on mycophenolic acid pharmacokinetics in stable renal transplant patients.
19644937 2010 Stereoselective metabolism of propranolol glucuronidation by human UDP-glucuronosyltransferases 2B7 and 1A9.
19571435 2009 In silico and in vitro approaches to elucidate the thermal stability of human UDP-glucuronosyltransferase (UGT) 1A9.
19545173 Structure and concentration changes affect characterization of UGT isoform-specific metabolism of isoflavones.
19494809 2009 UGT1A9 -275T>A/-2152C>T polymorphisms correlate with low MPA exposure and acute rejection in MMF/tacrolimus-treated kidney transplant patients.
19419973 2009 Common variants in the SLCO1B3 locus are associated with bilirubin levels and unconjugated hyperbilirubinemia.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
19364970 2009 Predictive role of the UGT1A1, UGT1A7, and UGT1A9 genetic variants and their haplotypes on the outcome of metastatic colorectal cancer patients treated with fluorouracil, leucovorin, and irinotecan.
19349540 2009 Comprehensive pharmacogenetic analysis of irinotecan neutropenia and pharmacokinetics.
19225446 2009 UGT genotype may contribute to adverse events following medication with mycophenolate mofetil in pediatric kidney transplant recipients.
19204906 2009 Analysis of inherited genetic variations at the UGT1 locus in the French-Canadian population.
19082692 2009 Metabolism and renal elimination of gaboxadol in humans: role of UDP-glucuronosyltransferases and transporters.
18981166 2009 Close association of UGT1A9 IVS1+399C>T with UGT1A1*28, *6, or *60 haplotype and its apparent influence on 7-ethyl-10-hydroxycamptothecin (SN-38) glucuronidation in Japanese.
18946804 2008 Influence of uridine diphosphate (UDP)-glucuronosyltransferases and ABCC2 genetic polymorphisms on the pharmacokinetics of mycophenolic acid and its metabolites in Chinese renal transplant recipients.
18816295 2008 Effect of D256N and Y483D on propofol glucuronidation by human uridine 5'-diphosphate glucuronosyltransferase (UGT1A9).
18695635 2008 Influence of drug transporters and UGT polymorphisms on pharmacokinetics of phenolic glucuronide metabolite of mycophenolic acid in Japanese renal transplant recipients.
18675828 2008 UGT1A1 and UGT1A9 functional variants, meat intake, and colon cancer, among Caucasians and African-Americans.
18602884 2008 Amino acid positions 69-132 of UGT1A9 are involved in the C-glucuronidation of phenylbutazone.
18597651 2008 Pharmacokinetics of mycophenolate mofetil and its glucuronide metabolites in healthy volunteers.
18568343 2008 Pharmacogenetic effect of the UGT polymorphisms on mycophenolate is modified by calcineurin inhibitors.
18502788 2008 Mutation analysis in UGT1A9 suggests a relationship between substrate and catalytic residues in UDP-glucuronosyltransferases.
18430559 2008 Glucuronidation of the soyabean isoflavones genistein and daidzein by human liver is related to levels of UGT1A1 and UGT1A9 activity and alters isoflavone response in the MCF-7 human breast cancer cell line.
18279479 2008 Population pharmacokinetic modelling for enterohepatic circulation of mycophenolic acid in healthy Chinese and the influence of polymorphisms in UGT1A9.
18221820 2009 Integrated pharmacogenetic prediction of irinotecan pharmacokinetics and toxicity in patients with advanced non-small cell lung cancer.
18052087 Disposition of flavonoids via enteric recycling: enzyme stability affects characterization of prunetin glucuronidation across species, organs, and UGT isoforms.
18004212 2007 Genetic diversity at the UGT1 locus is amplified by a novel 3' alternative splicing mechanism leading to nine additional UGT1A proteins that act as regulators of glucuronidation activity.
17965524 2007 Hepatocyte nuclear factor 1 alpha and 4 alpha are factors involved in interindividual variability in the expression of UGT1A6 and UGT1A9 but not UGT1A1, UGT1A3 and UGT1A4 mRNA in human livers.
17924828 2007 C-440T/T-331C polymorphisms in the UGT1A9 gene affect the pharmacokinetics of mycophenolic acid in kidney transplantation.
17761781 2007 Lack of association between common polymorphisms in UGT1A9 and gene expression and activity.
17700594 2008 Influence of UGT1A9 intronic I399C>T polymorphism on SN-38 glucuronidation in Asian cancer patients.
17576806 2007 Stereoselective glucuronidation of 5-(4'-hydroxyphenyl)-5-phenylhydantoin by human UDP-glucuronosyltransferase (UGT) 1A1, UGT1A9, and UGT2B15: effects of UGT-UGT interactions.
17558305 2007 Irinotecan pharmacokinetics/pharmacodynamics and UGT1A genetic polymorphisms in Japanese: roles of UGT1A1*6 and *28.
17529886 2007 Influence of UGT1A7 and UGT1A9 intronic I399 genetic polymorphisms on mycophenolic acid pharmacokinetics in Japanese renal transplant recipients.
17440429 2008 Hepatocyte nuclear factor-1 alpha is associated with UGT1A1, UGT1A9 and UGT2B7 mRNA expression in human liver.
17406868 2007 Genetic linkage of UGT1A7 and UGT1A9 polymorphisms to UGT1A1*6 is associated with reduced activity for SN-38 in Japanese patients with cancer.
17339869 2007 The impact of UGT1A8, UGT1A9, and UGT2B7 genetic polymorphisms on the pharmacokinetic profile of mycophenolic acid after a single oral dose in healthy volunteers.
17264800 2007 Hepatocyte nuclear factor1 transcription factors are essential for the UDP-glucuronosyltransferase 1A9 promoter response to hepatocyte nuclear factor 4alpha.
17179145 2007 Oligomerization of the UDP-glucuronosyltransferase 1A proteins: homo- and heterodimerization analysis by fluorescence resonance energy transfer and co-immunoprecipitation.
17115150 2007 Prevalence of UGT1A9 and UGT2B7 nonsynonymous single nucleotide polymorphisms in West African, Papua New Guinean, and North American populations.
17072959 2006 Lack of association between UGT1A7, UGT1A9, ARP, SPINK1 and CFTR gene polymorphisms and pancreatic cancer in Italian patients.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16636344 2006 Comprehensive analysis of UGT1A polymorphisms predictive for pharmacokinetics and treatment outcome in patients with non-small-cell lung cancer treated with irinotecan and cisplatin.
16397224 2006 Characterization of common UGT1A8, UGT1A9, and UGT2B7 variants with different capacities to inactivate mutagenic 4-hydroxylated metabolites of estradiol and estrone.
16344532 2005 Two patients with COMT inhibitor-induced hepatic dysfunction and UGT1A9 genetic polymorphism.
16198654 2005 The impact of uridine diphosphate-glucuronosyltransferase 1A9 (UGT1A9) gene promoter region single-nucleotide polymorphisms T-275A and C-2152T on early mycophenolic acid dose-interval exposure in de novo renal allograft recipients.
15864130 2005 Haplotypes of variants in the UDP-glucuronosyltransferase1A9 and 1A1 genes.
15855726 2005 Urinary excretion of phenytoin metabolites, 5-(4'-hydroxyphenyl)-5-phenylhydantoin and its O-glucuronide in humans and analysis of genetic polymorphisms of UDP-glucuronosyltransferases.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15712364 2005 Spectrum of UGT1A1 mutations in Crigler-Najjar (CN) syndrome patients: identification of twelve novel alleles and genotype-phenotype correlation.
15709193 2005 UGT1A7 and UGT1A9 polymorphisms predict response and toxicity in colorectal cancer patients treated with capecitabine/irinotecan.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15470081 2005 Hepatic expression of the UGT1A9 gene is governed by hepatocyte nuclear factor 4alpha.
15370961 2004 Stereoselective glucuronidation and hydroxylation of etodolac by UGT1A9 and CYP2C9 in man.
15286088 2004 Influence of genetic variants in UGT1A1 and UGT1A9 on the in vivo glucuronidation of SN-38.
15284532 2004 Identification of common polymorphisms in the promoter of the UGT1A9 gene: evidence that UGT1A9 protein and activity levels are strongly genetically controlled in the liver.
15258099 2004 The main role of UGT1A9 in the hepatic metabolism of mycophenolic acid and the effects of naturally occurring variants.
15115919 2004 A novel polymorphism in the promoter region of human UGT1A9 gene (UGT1A9*22) and its effects on the transcriptional activity.
15057901 2004 Variation of hepatic glucuronidation: Novel functional polymorphisms of the UDP-glucuronosyltransferase UGT1A4.
14672974 2004 Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation.
14660172 2003 Almokalant glucuronidation in human liver and kidney microsomes: evidence for the involvement of UGT1A9 and 2B7.
14550264 2003 Rapid proteasomal degradation of translocation-deficient UDP-glucuronosyltransferase 1A1 proteins in patients with Crigler-Najjar type II.
14521259 2003 Polymorphisms of heme oxygenase-1 and bilirubin UDP-glucuronosyltransferase genes are not associated with Kawasaki disease susceptibility.
12944498 2003 Novel functional polymorphisms in the UGT1A7 and UGT1A9 glucuronidating enzymes in Caucasian and African-American subjects and their impact on the metabolism of 7-ethyl-10-hydroxycamptothecin and flavopiridol anticancer drugs.
12847094 2003 Cloning and characterization of the human UDP-glucuronosyltransferase 1A8, 1A9, and 1A10 gene promoters: differential regulation through an interior-like region.
12623074 2003 Glucuronidation of catechols by human hepatic, gastric, and intestinal microsomal UDP-glucuronosyltransferases (UGT) and recombinant UGT1A6, UGT1A9, and UGT2B7.
12582161 2003 The UDP-glucuronosyltransferase 1A9 enzyme is a peroxisome proliferator-activated receptor alpha and gamma target gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12402338 2002 Association of a homozygous (TA)8 promoter polymorphism and a N400D mutation of UGT1A1 in a child with Crigler-Najjar type II syndrome.
12139570 2002 Novel missense mutation of the UGT1A1 gene in Thai siblings with Gilbert's syndrome.
11677206 2001 Genetic link of hepatocellular carcinoma with polymorphisms of the UDP-glucuronosyltransferase UGT1A7 gene.
11465080 2000 UDP-glucuronosyltransferases.
11434514 2001 Thirteen UDPglucuronosyltransferase genes are encoded at the human UGT1 gene complex locus.
11370628 2001 Interaction of coding region mutations and the Gilbert-type promoter abnormality of the UGT1A1 gene causes moderate degrees of unconjugated hyperbilirubinaemia and may lead to neonatal kernicterus.
11061796 2000 Prolonged unconjugated hyperbilirubinemia associated with breast milk and mutations of the bilirubin uridine diphosphate- glucuronosyltransferase gene.
11013440 2000 Genetic lesions of bilirubin uridine-diphosphoglucuronate glucuronosyltransferase (UGT1A1) causing Crigler-Najjar and Gilbert syndromes: correlation of genotype to phenotype.
10946897 2000 Characterization of the uridine diphosphate-glucuronosyltransferase-catalyzing thyroid hormone glucuronidation in man.
10836148 2000 Human UDP-glucuronosyltransferases: metabolism, expression, and disease.
10385426 1999 The monkey and human uridine diphosphate-glucuronosyltransferase UGT1A9, expressed in steroid target tissues, are estrogen-conjugating enzymes.
10335444 1999 Functions and transcriptional regulation of PAH-inducible human UDP-glucuronosyltransferases.
9847074 1998 Toward a complete human genome sequence.
9639672 1998 Coding defect and a TATA box mutation at the bilirubin UDP-glucuronosyltransferase gene cause Crigler-Najjar type I disease.
9627603 1998 Gilbert syndrome caused by a homozygous missense mutation (Tyr486Asp) of bilirubin UDP-glucuronosyltransferase gene.
9621515 1998 Analysis of bilirubin uridine 5'-diphosphate (UDP)-glucuronosyltransferase gene mutations in seven patients with Crigler-Najjar syndrome type II.
9295054 1997 The UDP glycosyltransferase gene superfamily: recommended nomenclature update based on evolutionary divergence.
8706880 1996 A mutation which disrupts the hydrophobic core of the signal peptide of bilirubin UDP-glucuronosyltransferase, an endoplasmic reticulum membrane protein, causes Crigler-Najjar type II.
8467709 1993 Assignment of the human UDP glucuronosyltransferase gene (UGT1A1) to chromosome region 2q37.
8280139 1993 Identification of defect in the genes for bilirubin UDP-glucuronosyl-transferase in a patient with Crigler-Najjar syndrome type II.
8276413 1993 Identification of an A-to-G missense mutation in exon 2 of the UGT1 gene complex that causes Crigler-Najjar syndrome type 2.
8226884 1993 A phenylalanine codon deletion at the UGT1 gene complex locus of a Crigler-Najjar type I patient generates a pH-sensitive bilirubin UDP-glucuronosyltransferase.
7989595 1994 Discrimination between Crigler-Najjar type I and II by expression of mutant bilirubin uridine diphosphate-glucuronosyltransferase.
7989045 1994 Genetic heterogeneity of Crigler-Najjar syndrome type I: a study of 14 cases.
7906695 1994 Identification of two single base substitutions in the UGT1 gene locus which abolish bilirubin uridine diphosphate glucuronosyltransferase activity in vitro.
7715297 1995 Analysis of genes for bilirubin UDP-glucuronosyltransferase in Gilbert's syndrome.
2108603 1990 Chromosomal mapping of a human phenol UDP-glucuronosyltransferase, GNT1.
1910331 1991 Cloning and stable expression of a new member of the human liver phenol/bilirubin: UDP-glucuronosyltransferase cDNA family.
1898728 1991 Cloning of two human liver bilirubin UDP-glucuronosyltransferase cDNAs with expression in COS-1 cells.
1634050 1992 Mechanisms of inherited deficiencies of multiple UDP-glucuronosyltransferase isoforms in two patients with Crigler-Najjar syndrome, type I.
1339448 1992 A novel complex locus UGT1 encodes human bilirubin, phenol, and other UDP-glucuronosyltransferase isozymes with identical carboxyl termini.