Property Summary

NCBI Gene PubMed Count 68
PubMed Score 41.80
PubTator Score 62.92

Knowledge Summary

Patent

No data available

Gene RIF (30)

PMID Text
26317684 Data suggest UGT1A8 is involved in differential metabolism of dietary flavonoids (glucosides and aglycones); glucuronidation of flavonoid glucosides is considerably slower than glucuronidation of flavonoid aglycones in microsomes of intestine/liver.
26247833 the in vitro glucuronidation of raloxifene in humans and monkeys was examined using liver and intestinal microsomes and recombinant UGT enzymes (UGT1A1, UGT1A8 and UGT1A9).
23721685 Genetic polymorphisms of UGT1A8, UGT1A9 and HNF-1alpha and gastrointestinal symptoms in renal transplant recipients taking mycophenolic acid.
23700788 A much higher frequency of UGT1A8*2 variant allele was found in Chinese than in Caucasians and Africans
23682072 UGT1A8 Polymorphism is associated with response to raloxifene in breast cancer.
22367021 The UGT1A8 and UGT2B4 genotypes associated with decreased predicted enzyme activities, were significantly associated with an increased risk of esophageal squamous cell carcinoma.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20565459 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20297805 The results also indicated that UGT1A1, UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2B7 are the most important six UGT isoforms for metabolizing the three dihydroxyflavones and seven monohydroxyflavones.
20147615 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19244109 Observational study of gene-disease association. (HuGE Navigator)
19225446 Observational study of gene-disease association. (HuGE Navigator)
18946804 the effect of UGT1A8 polymorphism on the pharmacokinetics of mycophenolic acid (MPA) and its metabolites phenolic glucuronide (MPAG) and acyl glucuronide (AcMPAG) in Chinese renal transplant
18946804 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18695635 In a study of Japanese renal transplant recipients, there are no significant differences in the area under the plasma concentration-time curve ratio of mycophenolic acid (MPA) glucuronide/MPA between UGT1A8 I399C/T genotypes.
18568343 The effect of UGT1A8 and UGT1A9 variants on mycophenolic acid metabolism appears to be modified by concomitant calcineurin inhibitor therapy.
18568343 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18454993 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18052087 UGT1A7, UGT1A8, and UGT1A9 were mainly responsible for formation of prunetin-5- O-glucuronide; UGT1A1, UGT1A8, and UGT1A10 were mainly responsible for formation of prunetin-4'- O-glucuronide; thermostability of microsomes was isoform- and organ-dependent
17603215 Results show UGT1A8 mRNA expression in primary hepatocytes by semi-quantitative RT-PCR.
17339869 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16397224 Observational study of genotype prevalence. (HuGE Navigator)
15319294 Observational study of gene-disease association. (HuGE Navigator)
15247627 Observational study of gene-disease association. (HuGE Navigator)
15057901 Observational study of gene-disease association. (HuGE Navigator)
12847094 UGT1A8, 1A9, and 1A10 genes are differentially regulated through an initiator element in their 5'-flanking regions

AA Sequence

MARTGWTSPIPLCVSLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLGKSL      1 - 70
NCTVKTYSTSYTLEDLDREFMDFADAQWKAQVRSLFSLFLSSSNGFFNLFFSHCRSLFNDRKLVEYLKES     71 - 140
SFDAVFLDPFDACGLIVAKYFSLPSVVFARGIACHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNH    141 - 210
IMHLEEHLFCQYFSKNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQG    211 - 280
KPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVK    281 - 350
WLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL    351 - 420
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIG    421 - 490
FLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                                  491 - 530
//

Text Mined References (74)

PMID Year Title
26317684 2015 Species- and gender-dependent differences in the glucuronidation of a flavonoid glucoside and its aglycone determined using expressed UGT enzymes and microsomes.
26247833 2016 Raloxifene glucuronidation in liver and intestinal microsomes of humans and monkeys: contribution of UGT1A1, UGT1A8 and UGT1A9.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23721685 2013 Genetic polymorphisms of UGT1A8, UGT1A9 and HNF-1? and gastrointestinal symptoms in renal transplant recipients taking mycophenolic acid.
23700788 2013 Genetic polymorphisms of UGT1A8, UGT1A9, UGT2B7 and ABCC2 in Chinese renal transplant recipients and a comparison with other ethnic populations.
23682072 2013 Characterization of raloxifene glucuronidation: potential role of UGT1A8 genotype on raloxifene metabolism in vivo.
23642732 2013 Association of SNPs in the UGT1A gene cluster with total bilirubin and mortality in the Diabetes Heart Study.
23371916 2013 A genome-wide association study for serum bilirubin levels and gene-environment interaction in a Chinese population.
23281178 2013 A genome-wide assessment of variability in human serum metabolism.
22558097 2012 A genome-wide association study of total bilirubin and cholelithiasis risk in sickle cell anemia.
22511988 2012 A genome-wide association study identifies UGT1A1 as a regulator of serum cell-free DNA in young adults: The Cardiovascular Risk in Young Finns Study.
22367021 2012 High enzyme activity UGT1A1 or low activity UGT1A8 and UGT2B4 genotypes increase esophageal cancer risk.
22085899 2012 UGT1A1 is a major locus influencing bilirubin levels in African Americans.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21646302 2011 Mayo Genome Consortia: a genotype-phenotype resource for genome-wide association studies with an application to the analysis of circulating bilirubin levels.
20972438 2010 A multi-stage genome-wide association study of bladder cancer identifies multiple susceptibility loci.
20732626 2010 Family-based genome-wide association scan of attention-deficit/hyperactivity disorder.
20639394 2010 Genome-wide association of serum bilirubin levels in Korean population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20610558 2010 Alternatively spliced products of the UGT1A gene interact with the enzymatically active proteins to inhibit glucuronosyltransferase activity in vitro.
20565459 2010 Risk of diarrhoea in a long-term cohort of renal transplant patients given mycophenolate mofetil: the significant role of the UGT1A8 2 variant allele.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20308471 2010 Role of UDP-glucuronosyltransferase isoforms in 13-cis retinoic acid metabolism in humans.
20297805 2010 Use of glucuronidation fingerprinting to describe and predict mono- and dihydroxyflavone metabolism by recombinant UGT isoforms and human intestinal and liver microsomes.
20147615 2010 Population pharmacokinetics and pharmacogenetics of mycophenolic acid following administration of mycophenolate mofetil in de novo pediatric renal-transplant patients.
20056724 2010 Phase II metabolism of hesperetin by individual UDP-glucuronosyltransferases and sulfotransferases and rat and human tissue samples.
19996319 2010 Modulation of the human glucuronosyltransferase UGT1A pathway by splice isoform polypeptides is mediated through protein-protein interactions.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19545173 Structure and concentration changes affect characterization of UGT isoform-specific metabolism of isoflavones.
19419973 2009 Common variants in the SLCO1B3 locus are associated with bilirubin levels and unconjugated hyperbilirubinemia.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
19244109 2009 Functional significance of UDP-glucuronosyltransferase variants in the metabolism of active tamoxifen metabolites.
19225446 2009 UGT genotype may contribute to adverse events following medication with mycophenolate mofetil in pediatric kidney transplant recipients.
19204906 2009 Analysis of inherited genetic variations at the UGT1 locus in the French-Canadian population.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18946804 2008 Influence of uridine diphosphate (UDP)-glucuronosyltransferases and ABCC2 genetic polymorphisms on the pharmacokinetics of mycophenolic acid and its metabolites in Chinese renal transplant recipients.
18695635 2008 Influence of drug transporters and UGT polymorphisms on pharmacokinetics of phenolic glucuronide metabolite of mycophenolic acid in Japanese renal transplant recipients.
18568343 2008 Pharmacogenetic effect of the UGT polymorphisms on mycophenolate is modified by calcineurin inhibitors.
18454993 2008 Influence of UDP-glucuronosyltransferase polymorphisms on mycophenolate mofetil-induced side effects in kidney transplant patients.
18052087 Disposition of flavonoids via enteric recycling: enzyme stability affects characterization of prunetin glucuronidation across species, organs, and UGT isoforms.
18004212 2007 Genetic diversity at the UGT1 locus is amplified by a novel 3' alternative splicing mechanism leading to nine additional UGT1A proteins that act as regulators of glucuronidation activity.
17603215 2007 Human UGT1A8 and UGT1A10 mRNA are expressed in primary human hepatocytes.
17339869 2007 The impact of UGT1A8, UGT1A9, and UGT2B7 genetic polymorphisms on the pharmacokinetic profile of mycophenolic acid after a single oral dose in healthy volunteers.
17179145 2007 Oligomerization of the UDP-glucuronosyltransferase 1A proteins: homo- and heterodimerization analysis by fluorescence resonance energy transfer and co-immunoprecipitation.
16397224 2006 Characterization of common UGT1A8, UGT1A9, and UGT2B7 variants with different capacities to inactivate mutagenic 4-hydroxylated metabolites of estradiol and estrone.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15319294 2004 Genetic polymorphisms in UDP-glucuronosyltransferases and glutathione S-transferases and colorectal cancer risk.
15247627 2004 Functional polymorphisms of UDP-glucuronosyltransferases 1A1, 1A6 and 1A8 are not involved in chronic pancreatitis.
15057901 2004 Variation of hepatic glucuronidation: Novel functional polymorphisms of the UDP-glucuronosyltransferase UGT1A4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14672974 2004 Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation.
12920167 2003 Glucuronidation of anabolic androgenic steroids by recombinant human UDP-glucuronosyltransferases.
12847094 2003 Cloning and characterization of the human UDP-glucuronosyltransferase 1A8, 1A9, and 1A10 gene promoters: differential regulation through an interior-like region.
12639971 2003 Glucuronidation of arachidonic and linoleic acid metabolites by human UDP-glucuronosyltransferases.
12433820 2002 Troglitazone glucuronidation in human liver and intestine microsomes: high catalytic activity of UGT1A8 and UGT1A10.
12042666 2002 Identification and functional characterization of UDP-glucuronosyltransferases UGT1A8*1, UGT1A8*2 and UGT1A8*3.
11901093 2002 Glucuronidation: an important mechanism for detoxification of benzo[a]pyrene metabolites in aerodigestive tract tissues.
11465080 2000 UDP-glucuronosyltransferases.
11434514 2001 Thirteen UDPglucuronosyltransferase genes are encoded at the human UGT1 gene complex locus.
11179460 2001 Glucuronidation of the nonsteroidal antiestrogen EM-652 (SCH 57068), by human and monkey steroid conjugating UDP-glucuronosyltransferase enzymes.
10836148 2000 Human UDP-glucuronosyltransferases: metabolism, expression, and disease.
10497143 1999 Studies on the substrate specificity of human intestinal UDP- lucuronosyltransferases 1A8 and 1A10.
9705221 1998 Cloning and expression of human UDP-glucuronosyltransferase (UGT) 1A8.
9647757 1998 Characterization of two UDP glucuronosyltransferases that are predominantly expressed in human colon.
9535849 1998 Expression of the UDP-glucuronosyltransferase 1A locus in human colon. Identification and characterization of the novel extrahepatic UGT1A8.
9295054 1997 The UDP glycosyltransferase gene superfamily: recommended nomenclature update based on evolutionary divergence.
8467709 1993 Assignment of the human UDP glucuronosyltransferase gene (UGT1A1) to chromosome region 2q37.
1339448 1992 A novel complex locus UGT1 encodes human bilirubin, phenol, and other UDP-glucuronosyltransferase isozymes with identical carboxyl termini.