Property Summary

NCBI Gene PubMed Count 116
PubMed Score 608.62
PubTator Score 200.09

Knowledge Summary

Patent

No data available

Expression

Gene RIF (87)

AA Sequence

MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVVPEVNLLLKES      1 - 70
KYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFK     71 - 140
ESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKFSDHMTFSQRVA    141 - 210
NFLVNLLEPYLFYCLFSKYEELASAVLKRDVDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCK    211 - 280
KRKDLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTIL    281 - 350
VKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSE    351 - 420
DLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDV    421 - 490
IGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                                491 - 532
//

Text Mined References (120)

PMID Year Title