Property Summary

NCBI Gene PubMed Count 71
PubMed Score 59.79
PubTator Score 160.96

Knowledge Summary

Patent

No data available

Protein-protein Interaction (2)

Gene RIF (36)

PMID Text
26303110 Influence of valproic acid concentration and polymorphism of UGT1A4*3, UGT2B7 -161C > T and UGT2B7*2 on serum concentration of lamotrigine in Chinese epileptic children
26176234 This descriptive study examines correlations between concentrations of tamoxifen's glucuronide metabolites and genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 in 132 patients with estrogen receptor-positive breast cancer under treatment with tamoxifen
26010150 in tumor liver microsomes from HCC patients, either V(max) (maximum reaction rate, R(max) for UGT1A1) or clearance rates (V(max)/K(m), Clint) of UGT1A, UGT1A1, UGT1A4, UGT1A9 and UGT2B7 were lower than those in the adjacent normal liver microsomes
24917585 The association between the UGT1A4 promoter and coding region SNPs and the glucuronidation rates of Tam.
24820767 Correlation of the UGT1A4 gene polymorphism with serum concentration and therapeutic efficacy of lamotrigine in Han Chinese of Northern China
24641623 Human UGT1A4 and UGT1A3 conjugate 25-hydroxyvitamin D3.
23611809 the substrate specificity of UGT2B10, highlighting its preference for tertiary amines with higher affinities and clearance values than those of UGT1A4 and UGT1A3.
23277392 Present results could be helpful to improve the use of UGT1A4 drug substrates in order to adjust them to the ethnic background of a given population, specifically for Hispanics.
22713701 Polymorphic glucuronidation of olanzapine by uridine diphosphate glucuronosyltransferase 1A4 (UGT1A4) was investigated retrospectively in patient samples
22367373 study to determine the allelic frequency of two most common defective alleles: UGT1A4*2 and UGT1A4*3 in a Jordanian population
22047493 UGT1A4(P24T) and UGT1A4(L48V) on LTG glucuronidation may lead to interindividual variations in lamotrigine metabolism in vivo
21601426 The frequencies of the heterozygous alleles for L48V or P24T polymorphisms were 22.4% and 3.8%, respectively. L48V polymorphism was found to decrease the serum lamotrigine concentration in Turkish epilepsy patients on monotherapy or polytherapy.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20007295 kinetic studies with recombinant UGT1A4 using various substrates: dihydrotestosterone, trans-androsterone, tamoxifen, lamotrigine -- evidence for multiple substrate binding sites
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19890225 Study identified a large number of genetic variations, including 13 intronic, 39 promoter, as well as 14 exonic polymorphisms, with 10 that lead to amino-acid changes.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19204906 Observational study of genotype prevalence. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18632753 Observational study of gene-disease association. (HuGE Navigator)
18433817 AhR-mediated regulation of the human UGT1A4 gene by two xenobiotic response elements and a modulation by single nucleotide polymorphisms is demonstrated
18433817 Observational study of gene-disease association. (HuGE Navigator)
18223460 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18223459 Observational study of genotype prevalence. (HuGE Navigator)
18161889 Observational study of gene-disease association. (HuGE Navigator)
17556526 hepatic clearance of trifluoperazine by UGT1A4 did not reach maximum levels until 18.9 years of age
15855727 Observational study of genotype prevalence. (HuGE Navigator)
15855726 Observational study of gene-disease association. (HuGE Navigator)
15708967 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15057901 Observational study of gene-disease association. (HuGE Navigator)
15057901 Two polymorphisms of the hepatic UGT1A4 protein show a differential metabolic activity toward mutagenic amines and endogenous steroids, altering hepatic metabolism and detoxification.
14871856 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARGLQVPLPRLATGLLLLLSVQPWAESGKVLVVPTDGSPWLSMREALRELHARGHQAVVLTPEVNMHIK      1 - 70
EEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNVSLALHRCCVELLHNEALIRH     71 - 140
LNATSFDVVLTDPVNLCGAVLAKYLSIPAVFFWRYIPCDLDFKGTQCPNPSSYIPKLLTTNSDHMTFLQR    141 - 210
VKNMLYPLALSYICHTFSAPYASLASELFQREVSVVDLVSYASVWLFRGDFVMDYPRPIMPNMVFIGGIN    211 - 280
CANGKPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNT    281 - 350
ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT    351 - 420
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSL    421 - 490
DVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                              491 - 534
//

Text Mined References (78)

PMID Year Title
26303110 2015 Influence of valproic acid concentration and polymorphism of UGT1A4*3, UGT2B7 -161C?>?T and UGT2B7*2 on serum concentration of lamotrigine in Chinese epileptic children.
26176234 2015 Impacts of the Glucuronidase Genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 on Tamoxifen Metabolism in Breast Cancer Patients.
26010150 2015 Drug-Metabolizing Activity, Protein and Gene Expression of UDP-Glucuronosyltransferases Are Significantly Altered in Hepatocellular Carcinoma Patients.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24917585 2014 A potential role for human UDP-glucuronosyltransferase 1A4 promoter single nucleotide polymorphisms in the pharmacogenomics of tamoxifen and its derivatives.
24820767 2014 Correlation of the UGT1A4 gene polymorphism with serum concentration and therapeutic efficacy of lamotrigine in Han Chinese of Northern China.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24641623 2014 Human UGT1A4 and UGT1A3 conjugate 25-hydroxyvitamin D3: metabolite structure, kinetics, inducibility, and interindividual variability.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23642732 2013 Association of SNPs in the UGT1A gene cluster with total bilirubin and mortality in the Diabetes Heart Study.
23611809 2013 Human UDP-glucuronosyltransferase (UGT) 2B10 in drug N-glucuronidation: substrate screening and comparison with UGT1A3 and UGT1A4.
23371916 2013 A genome-wide association study for serum bilirubin levels and gene-environment interaction in a Chinese population.
23281178 2013 A genome-wide assessment of variability in human serum metabolism.
23277392 2013 Interethnic differences in UGT1A4 genetic polymorphisms between Mexican Mestizo and Spanish populations.
22713701 2012 UGT1A4*3 encodes significantly increased glucuronidation of olanzapine in patients on maintenance treatment and in recombinant systems.
22579593 2012 Simultaneous evaluation of six human glucuronidation activities in liver microsomes using liquid chromatography-tandem mass spectrometry.
22558097 2012 A genome-wide association study of total bilirubin and cholelithiasis risk in sickle cell anemia.
22511988 2012 A genome-wide association study identifies UGT1A1 as a regulator of serum cell-free DNA in young adults: The Cardiovascular Risk in Young Finns Study.
22367373 2012 UDP-glucuronosyltransferase 1A4 (UGT1A4) polymorphisms in a Jordanian population.
22085899 2012 UGT1A1 is a major locus influencing bilirubin levels in African Americans.
22047493 2011 Functional analysis of UGT1A4(P24T) and UGT1A4(L48V) variant enzymes.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21646302 2011 Mayo Genome Consortia: a genotype-phenotype resource for genome-wide association studies with an application to the analysis of circulating bilirubin levels.
21601426 2011 The relationship between UGT1A4 polymorphism and serum concentration of lamotrigine in patients with epilepsy.
20639394 2010 Genome-wide association of serum bilirubin levels in Korean population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20610558 2010 Alternatively spliced products of the UGT1A gene interact with the enzymatically active proteins to inhibit glucuronosyltransferase activity in vitro.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20308471 2010 Role of UDP-glucuronosyltransferase isoforms in 13-cis retinoic acid metabolism in humans.
20007295 2010 Glucuronidation of dihydrotestosterone and trans-androsterone by recombinant UDP-glucuronosyltransferase (UGT) 1A4: evidence for multiple UGT1A4 aglycone binding sites.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19890225 2009 A pharmacogenetics study of the human glucuronosyltransferase UGT1A4.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19419973 2009 Common variants in the SLCO1B3 locus are associated with bilirubin levels and unconjugated hyperbilirubinemia.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
19204906 2009 Analysis of inherited genetic variations at the UGT1 locus in the French-Canadian population.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18632753 2008 Bladder cancer risk and genetic variation in AKR1C3 and other metabolizing genes.
18433817 2008 Genetic variability of aryl hydrocarbon receptor (AhR)-mediated regulation of the human UDP glucuronosyltransferase (UGT) 1A4 gene.
18223460 2008 The relationship between the response of clinical symptoms and plasma olanzapine concentration, based on pharmacogenetics: Juntendo University Schizophrenia Projects (JUSP).
18223459 2008 Genetic variations and haplotypes of UDP-glucuronosyltransferase 1A locus in a Korean population.
18161889 2008 Detoxification enzyme polymorphisms are not involved in duodenal adenomatosis in familial adenomatous polyposis.
18004212 2007 Genetic diversity at the UGT1 locus is amplified by a novel 3' alternative splicing mechanism leading to nine additional UGT1A proteins that act as regulators of glucuronidation activity.
17556526 2007 Pediatric development of glucuronidation: the ontogeny of hepatic UGT1A4.
17496722 2007 Molecular pathogenesis of Gilbert's syndrome: decreased TATA-binding protein binding affinity of UGT1A1 gene promoter.
17179145 2007 Oligomerization of the UDP-glucuronosyltransferase 1A proteins: homo- and heterodimerization analysis by fluorescence resonance energy transfer and co-immunoprecipitation.
15855727 2005 Genetic variations and haplotypes of UGT1A4 in a Japanese population.
15855726 2005 Urinary excretion of phenytoin metabolites, 5-(4'-hydroxyphenyl)-5-phenylhydantoin and its O-glucuronide in humans and analysis of genetic polymorphisms of UDP-glucuronosyltransferases.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15708967 2005 UDP-glucuronosyltransferase 1A4 polymorphisms in a Japanese population and kinetics of clozapine glucuronidation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15135306 2004 Quaternary ammonium-linked glucuronidation of tamoxifen by human liver microsomes and UDP-glucuronosyltransferase 1A4.
15057901 2004 Variation of hepatic glucuronidation: Novel functional polymorphisms of the UDP-glucuronosyltransferase UGT1A4.
14871856 2004 Correlation between UDP-glucuronosyltransferase genotypes and 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone glucuronidation phenotype in human liver microsomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14672974 2004 Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation.
14570768 2003 N-glucuronidation of nicotine and cotinine by human liver microsomes and heterologously expressed UDP-glucuronosyltransferases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12433823 2002 Characterization of nicotine and cotinine N-glucuronidations in human liver microsomes.
11465080 2000 UDP-glucuronosyltransferases.
11434514 2001 Thirteen UDPglucuronosyltransferase genes are encoded at the human UGT1 gene complex locus.
10836148 2000 Human UDP-glucuronosyltransferases: metabolism, expression, and disease.
10220490 1999 Retigabine N-glucuronidation and its potential role in enterohepatic circulation.
9535849 1998 Expression of the UDP-glucuronosyltransferase 1A locus in human colon. Identification and characterization of the novel extrahepatic UGT1A8.
9295054 1997 The UDP glycosyltransferase gene superfamily: recommended nomenclature update based on evolutionary divergence.
9271343 1997 Differential expression of the UGT1A locus in human liver, biliary, and gastric tissue: identification of UGT1A7 and UGT1A10 transcripts in extrahepatic tissue.
8467709 1993 Assignment of the human UDP glucuronosyltransferase gene (UGT1A1) to chromosome region 2q37.
8280139 1993 Identification of defect in the genes for bilirubin UDP-glucuronosyl-transferase in a patient with Crigler-Najjar syndrome type II.
8276413 1993 Identification of an A-to-G missense mutation in exon 2 of the UGT1 gene complex that causes Crigler-Najjar syndrome type 2.
1898728 1991 Cloning of two human liver bilirubin UDP-glucuronosyltransferase cDNAs with expression in COS-1 cells.
1634050 1992 Mechanisms of inherited deficiencies of multiple UDP-glucuronosyltransferase isoforms in two patients with Crigler-Najjar syndrome, type I.
1339448 1992 A novel complex locus UGT1 encodes human bilirubin, phenol, and other UDP-glucuronosyltransferase isozymes with identical carboxyl termini.