Property Summary

NCBI Gene PubMed Count 59
PubMed Score 55.40
PubTator Score 84.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 503
Disease Target Count Z-score Confidence
Anemia 252 0.0 2.0
Disease Target Count
Sickle Cell Anemia 54

Gene RIF (21)

PMID Text
25743847 Increased UGT1A3 expression is associated with pancreatic cancer.
24641623 Human UGT1A4 and UGT1A3 conjugate 25-hydroxyvitamin D3.
23611809 the substrate specificity of UGT2B10, highlighting its preference for tertiary amines with higher affinities and clearance values than those of UGT1A4 and UGT1A3.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20189675 Transcriptional regulation of the human bile acid and xenobiotic UGT1A3 by its substrate CDCA and FXR is shown
20142249 Observational study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19891553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19889628 The human UGT1A3 enzyme conjugates norursodeoxycholic acid into a C23-ester glucuronide in the liver.
19303655 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19204906 Observational study of genotype prevalence. (HuGE Navigator)
18677463 These data demonstrate xenobiotic induced regulation of the UGT1A3 gene by the aryl hydrocarbon receptor, which shows genetic variability
18677463 Observational study of genotype prevalence. (HuGE Navigator)
18161889 Observational study of gene-disease association. (HuGE Navigator)
17558304 established the genetic mechanisms that might contribute to individual variation in UGT1A3 expression and activity
16738032 Observational study of genotype prevalence. (HuGE Navigator)
15057901 Observational study of gene-disease association. (HuGE Navigator)
14986168 Observational study of gene-disease association. (HuGE Navigator)
14986168 six UGT 1A3 polymorphisms in the Japanese population were shown to have different levels of activity

AA Sequence

MATGLQVPLPWLATGLLLLLSVQPWAESGKVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIK      1 - 70
EENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCVELLHNEALIRH     71 - 140
LNATSFDVVLTDPVNLCAAVLAKYLSIPTVFFLRNIPCDLDFKGTQCPNPSSYIPRLLTTNSDHMTFMQR    141 - 210
VKNMLYPLALSYICHAFSAPYASLASELFQREVSVVDILSHASVWLFRGDFVMDYPRPIMPNMVFIGGIN    211 - 280
CANRKPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNT    281 - 350
ILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT    351 - 420
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSL    421 - 490
DVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                              491 - 534
//

Text Mined References (63)

PMID Year Title
25743847 2015 Increased UGT1A3 and UGT1A7 expression is associated with pancreatic cancer.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24641623 2014 Human UGT1A4 and UGT1A3 conjugate 25-hydroxyvitamin D3: metabolite structure, kinetics, inducibility, and interindividual variability.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23642732 2013 Association of SNPs in the UGT1A gene cluster with total bilirubin and mortality in the Diabetes Heart Study.
23611809 2013 Human UDP-glucuronosyltransferase (UGT) 2B10 in drug N-glucuronidation: substrate screening and comparison with UGT1A3 and UGT1A4.
23371916 2013 A genome-wide association study for serum bilirubin levels and gene-environment interaction in a Chinese population.
23281178 2013 A genome-wide assessment of variability in human serum metabolism.
22579593 2012 Simultaneous evaluation of six human glucuronidation activities in liver microsomes using liquid chromatography-tandem mass spectrometry.
22558097 2012 A genome-wide association study of total bilirubin and cholelithiasis risk in sickle cell anemia.
22511988 2012 A genome-wide association study identifies UGT1A1 as a regulator of serum cell-free DNA in young adults: The Cardiovascular Risk in Young Finns Study.
22085899 2012 UGT1A1 is a major locus influencing bilirubin levels in African Americans.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21646302 2011 Mayo Genome Consortia: a genotype-phenotype resource for genome-wide association studies with an application to the analysis of circulating bilirubin levels.
20639394 2010 Genome-wide association of serum bilirubin levels in Korean population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20610558 2010 Alternatively spliced products of the UGT1A gene interact with the enzymatically active proteins to inhibit glucuronosyltransferase activity in vitro.
20308471 2010 Role of UDP-glucuronosyltransferase isoforms in 13-cis retinoic acid metabolism in humans.
20189675 2010 Regulation of the human bile acid UDP-glucuronosyltransferase 1A3 by the farnesoid X receptor and bile acids.
20142249 2010 Associations between polymorphisms in glucuronidation and sulfation enzymes and mammographic breast density in premenopausal women in the United States.
20056724 2010 Phase II metabolism of hesperetin by individual UDP-glucuronosyltransferases and sulfotransferases and rat and human tissue samples.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19891553 2009 Genetic polymorphisms of drug-metabolizing enzymes and anti-TB drug-induced hepatitis.
19889628 2010 The human UGT1A3 enzyme conjugates norursodeoxycholic acid into a C23-ester glucuronide in the liver.
19419973 2009 Common variants in the SLCO1B3 locus are associated with bilirubin levels and unconjugated hyperbilirubinemia.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
19303655 2009 Gilbert's syndrome and hyperbilirubinemia in protease inhibitor therapy--an extended haplotype of genetic variants increases risk in indinavir treatment.
19204906 2009 Analysis of inherited genetic variations at the UGT1 locus in the French-Canadian population.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18677463 2008 Aryl hydrocarbon receptor-mediated regulation of the human estrogen and bile acid UDP-glucuronosyltransferase 1A3 gene.
18674515 2008 The human UDP-glucuronosyltransferase UGT1A3 is highly selective towards N2 in the tetrazole ring of losartan, candesartan, and zolarsartan.
18161889 2008 Detoxification enzyme polymorphisms are not involved in duodenal adenomatosis in familial adenomatous polyposis.
18052087 Disposition of flavonoids via enteric recycling: enzyme stability affects characterization of prunetin glucuronidation across species, organs, and UGT isoforms.
18004212 2007 Genetic diversity at the UGT1 locus is amplified by a novel 3' alternative splicing mechanism leading to nine additional UGT1A proteins that act as regulators of glucuronidation activity.
17558304 2007 A pharmacogenomics study of the human estrogen glucuronosyltransferase UGT1A3.
17179145 2007 Oligomerization of the UDP-glucuronosyltransferase 1A proteins: homo- and heterodimerization analysis by fluorescence resonance energy transfer and co-immunoprecipitation.
16738032 2006 Genetic variants of human UGT1A3: functional characterization and frequency distribution in a Chinese Han population.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15057901 2004 Variation of hepatic glucuronidation: Novel functional polymorphisms of the UDP-glucuronosyltransferase UGT1A4.
15047194 2004 Glucuronidation of carboxylic acid containing compounds by UDP-glucuronosyltransferase isoforms.
14986168 2004 Six novel UDP-glucuronosyltransferase (UGT1A3) polymorphisms with varying activity.
14672974 2004 Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation.
14570768 2003 N-glucuronidation of nicotine and cotinine by human liver microsomes and heterologously expressed UDP-glucuronosyltransferases.
12639971 2003 Glucuronidation of arachidonic and linoleic acid metabolites by human UDP-glucuronosyltransferases.
11465080 2000 UDP-glucuronosyltransferases.
11434514 2001 Thirteen UDPglucuronosyltransferase genes are encoded at the human UGT1 gene complex locus.
11179460 2001 Glucuronidation of the nonsteroidal antiestrogen EM-652 (SCH 57068), by human and monkey steroid conjugating UDP-glucuronosyltransferase enzymes.
11179432 2001 Genetic multiplicity of the human UDP-glucuronosyltransferases and regulation in the gastrointestinal tract.
10836148 2000 Human UDP-glucuronosyltransferases: metabolism, expression, and disease.
10748067 2000 Polymorphic gene regulation and interindividual variation of UDP-glucuronosyltransferase activity in human small intestine.
9616184 1998 Glucuronidation of amines and other xenobiotics catalyzed by expressed human UDP-glucuronosyltransferase 1A3.
9535849 1998 Expression of the UDP-glucuronosyltransferase 1A locus in human colon. Identification and characterization of the novel extrahepatic UGT1A8.
9295054 1997 The UDP glycosyltransferase gene superfamily: recommended nomenclature update based on evolutionary divergence.
9271343 1997 Differential expression of the UGT1A locus in human liver, biliary, and gastric tissue: identification of UGT1A7 and UGT1A10 transcripts in extrahepatic tissue.
9230212 1997 Differential down-regulation of the UDP-glucuronosyltransferase 1A locus is an early event in human liver and biliary cancer.
8780690 1996 cDNA cloning and characterization of the human UDP glucuronosyltransferase, UGT1A3.
1503396 1992 Chromosomal assignment of human phenol and bilirubin UDP-glucuronosyltransferase genes (UGT1A-subfamily).
1339448 1992 A novel complex locus UGT1 encodes human bilirubin, phenol, and other UDP-glucuronosyltransferase isozymes with identical carboxyl termini.