Property Summary

NCBI Gene PubMed Count 576
PubMed Score 893.86
PubTator Score 1317.79

Knowledge Summary

Patent

No data available

Protein-protein Interaction (2)

Gene RIF (602)

PMID Text
27264814 compound UGT1A1 gene mutation probably accounts for the disease in the patient manifesting persistent mild unconjugated hyperbilirubinemia
26857783 UGT1A1*6 and UGT1A1*28 polymorphisms were associated with severe neutropenia
26773202 This review presents an overview of the clinical effects of UGT1A1 polymorphisms on the pharmacology of UGT1A1 substrates, with a special focus on the novel histone deacetylase inhibitor belinostat. [review]
26751466 smoking or alcohol consumption and the rs4148323 G allele of UGT1A1 act synergistically to increase the risk of laryngeal cancer
26716871 single nucleotide variations in Indian subjects with unconjugated hyperbilirubinemia
26697581 Case Report: mutations in UGT1A1 gene that resulted in residual enzymatic activity in related Iranian subjects with Crigler-Najjar syndrome type I (CN-1) and type II.
26645279 UGT1A1 Polymorphisms Predict Recurrence of Non-Muscle-Invasive Bladder Cancer.
26628212 Strong linkage disequilibrium was observed across a 200 kb region spanning the UDP-glucuronosyltransferase family, including UGT1A1, an enzyme known to metabolise bilirubin.
26494856 This trial does not support the use of the intensive treatment with HD-FOLFIRI plus bevacizumab combination for Metastatic Colorectal Cancer in patients with the UGTA1*1/UGT1A1*1 or UGT1A1*1/UGT1A1*28 genotype
26482555 GMP scores of cancerous tissue combined with UGT1A1 genotyping of blood samples may serve as highly potent markers for predicting the efficacy of NAC for individual SCC patients.
26467199 UGT1A1 polymorphisms (Gly71Arg and TATA promoter) significantly increase the risk of neonatal hyperbilirubinemia [meta-analysis]
26403473 A thalassemia patient has been found to be a carrier of UGT1A1 and ABCC2 polymorphisms explaining a possible reduction of desferasirox metabolism together with a reduction of biliary elimination by MRP2 and causing a serious adverse reaction.
26250421 Genotype of UGT1A1 and phenotype correlation between Crigler-Najjar syndrome type II and Gilbert syndrome.(
26247833 the in vitro glucuronidation of raloxifene in humans and monkeys was examined using liver and intestinal microsomes and recombinant UGT enzymes (UGT1A1, UGT1A8 and UGT1A9).
26229432 In Chinese patients with pancreatic or biliary tract cancer administered irinotecan-containing regimens, those with UGT1A1*6 variant may have a high risk of severe neutropenia
26223945 Suggest that UGT1A1 SNPs could be a determinant of stable warfarin doses in patients with mechanical heart valves.
26200705 UGT1A1 G71R mutation is a risk factor for neonatal hyperbilirubinemia in Guangxi Heiyi Zhuang and Han populations. UGT1A1 (TA)7 insertion mutation is not associated with neonatal hyperbilirubinemia in the two ethnic groups.
26146841 increasing gestational age and the presence of -TA7 repeat variant of UGT1A1 decreased the risk of neonatal hyperbilirubinemia.
26125934 The UGT1A1*28 gene mutation might increase the risk of diarrhea with irinotecan-based chemotherapy.
26125716 The large number of subjects who were HBV-positive carriers of heterozygosis or homozygosis for the UGT1A1*28 (TA)7 polymorphism suggests that these individuals may be more susceptible to cancer and should follow a strict regime of prevention.
26068529 UGT1A1-overexpressing HeLa cells were an appropriate tool to accurately depict the inhibition profiles of chemicals against UGT1A1.
26068521 niclosamide was subjected to efficient metabolic reactions hydroxylation and glucuronidation, wherein CYP1A2 and UGT1A1 were the main contributing enzymes, respectively.
26039129 Identified coding variants on UGT1A1 and UGT1A6 genes in association with serum bilirubin level and hyperbilirubinemia risk in elderly subjects.
26010150 in tumor liver microsomes from HCC patients, either V(max) (maximum reaction rate, R(max) for UGT1A1) or clearance rates (V(max)/K(m), Clint) of UGT1A, UGT1A1, UGT1A4, UGT1A9 and UGT2B7 were lower than those in the adjacent normal liver microsomes
25997248 Our results indicate an influence of UGT1A1*28 allele on the formation clearance of both bazedoxifene metabolites
25993113 The spectrum of UGT1A1 variations in Crigler-Najjar syndrome type II differs according to the bilirubin levels.
25981652 analysis of UGT1A1 genetic polymorphisms in these patients yielded the following classifications: a wild-type group( *1/*1)comprising 13 patients(52%), a heterozygous group of 10 patients
25967674 Different alleles for UGT1A1*6 were identified in an Iranian population made up of different ethnic groups.
25953521 UGT1A1 play an important role in function regulation of endogenous compounds in a region- and age-dependent manner
25822733 A new c.C1582T (p.R523X) mutation was found in a Crigler Najjar type II patient and his mother. The protein lacks 10 amino acids with five basic groups (1 Arg and 4 Lys). It irreversibly alters the halt-transfer signal.
25782327 Single nucleotide polymorphisms (SNPs) in Dihydropyrimidine Dehydrogenase and UGT1A1 influence fluoropyrimdines and irinotecan adverse events (AEs).
25778466 For the two-marker haplotype rs11563250G and UGT1A1*1 (rs8175347 TA6), the OR was of 0.17 (P=0.0004).
25760534 In human liver microsomes prepared from poor metabolizers (UGT1A1*28/*28), significantly reduced trovafloxacin acyl-glucuronide formation activity was observed, indicating that UGT1A1 mainly contributes to the glucuronidation of trovafloxacin.
25741749 UGT1A1 glucuronidation in HeLa cells is decreased by efflux transporters
25712374 Expression changes of UGT1A genes can affect the development and progression of various types of cancer including the cancer of the stomach
25611851 UGT1A1 gene polymorphism is one of the causes of Gilbert's syndrome in Taiwanese population.
25545261 The UGT1A1*28 and UGT1A1*6 alleles were found to be similar in the Asian populations.
25488668 impaired glycosyltransferase activity in mutant EOGT proteins and the consequent defective O-GlcNAcylation in the ER constitute the molecular basis for Adams-Oliver syndrome
25478904 result suggests that the haplotypes in UGT1A1 promoter region can affect the expression level of the gene and drug metabolism associated with UGT1A1.
25450281 UGT1A1 FNx01 28 polymorphism failed to predict the incidence of serious adverse effects and efficacy of irinotecan.
25391605 UGT1A1, SLCO1B1 and SLCO1B3 polymorphisms become risk factors in neonates showing 10% or greater body weight loss during the neonatal period. Inadequate feeding may increase the bilirubin burden and cause apparent hyperbilirubinemia in neonates.
25368098 We used rs6742078 located in the uridine diphosphate-glucuronosyltransferase locus as an instrumental variable to study a serum total bilirubin level effect on type 2 diabetes risk. elevated bilirubin is associated with the risk of type 2 diabetes.
25312789 UGT1A1(TA)n polymorphisms were associated with a requirement for higher warfarin dose for thrombosis.
25262300 UGT1A1 is asscoiated with bilirubin kinetics during the first week of life and is associated with neonatal hyperbilirubinemia
25260839 The cytotoxicity of CPT-11 to colorectal cancer cells has a negative correlation with UGT1A1 expression.
25200497 This study identified four novel UGT1A1 coding variants.
25141892 On the title.
25105254 No association between the UGT1A1*28 genotypes and acute lymphoblastic leukemia in children.
25102181 significance of UGT1A1 in association with neonatal hyperbilirubinemia in East Asian population.
25092941 No association is found between the UGT1A1*28 allele and extreme hyperbilirubinemia in a case-control study of 231 white infants who had had extreme hyperbilirubinemia in Denmark from 2000 to 2007.
25086287 Genetically raised unconjugated serum bilirubin (UGT1A1 in Gilbert's syndrome)is associated with higher adult respiratory function and protection from respiratory disease.
25072305 A single neonatal hUGT1A1 gene transfer was successful to correct a lethal mouse model of Crigler-Najjar hyperbilirubinemia, with the therapeutic effect lasting up to 17 months postinjection.
25055799 The survival rate after initial CDE-11 treatment was significantly higher in diffuse large B-cell lymphoma pateints with UGT1A1*6 polymorphism.
25016708 A high-resolution melting analysis was designed to characterize the UGT1A1 gene. The promoter and 11 exons from UGT1A1 were screened by HRM, and all results were subsequently confirmed by direct DNA sequencing.
24977443 It is reasonable to genotype UGT1A1 variants, frequently deficient in caucasians, to determine the optimal iritecan dosage.
24958824 The UGT1A1*28 genotype can be used to individualize dosing of irinotecan.
24947795 Polymorphisms in UGT1A1 contribute to risk of developing hyperbilirubenemia and gallstones in patients with spherocytosis.
24901842 In obese children and adolescents, body fat composition and UGT1A1 polymorphism are independent determinants of total bilirubin levels.
24898899 Patients at increased hyperbilirubinemia risk could be identified by prospective UGT1A1 genotyping prior to nilotinib therapy.
24865931 study demonstrates that UGT1A1 and OATP2 polymorphisms were associated with altered bilirubin metabolism and could be genetic risk factors for neonatal hyperbilirubinemia
24856997 UGT1A1 G71R missense mutation is a risk factor for hyperbilirubinemia in neonates of Guangxi Heiyi Zhuang nationality.
24815493 patients with a UGT1A1*28 allele will suffer an increased risk of severe irinotecan-induced diarrhea, whether with mid-or low-dosage. However, the UGT1A1*28 allele did not increase severe neutropenia.
24793765 In summary, we detected three UGT1A1 mutations in two CN-I patients: c.239_245delCTGTGCC (p.Pro80HisfsX6), c.1253delT (p.Met418ArgfsX5), and c.1156G>T (p.Val386Phe).
24726540 GS polymorphism alone does not appear to play a major role in severe neonatal hyperbilirubinemia in neonates without signs of hemolysis
24709690 Meta-analysis: the effect of the UGT1A1*28 allele on survival after irinotecan-based chemotherapy
24690955 The UGT1A1*28 polymorphism is associated with changes in serum bilirubin and with graft outcome after kidney transplantation
24650397 prolonged unconjugated hyperbilirubinemia may develop in infants with UGT1A1*6 who are fed breast milk
24620945 Results indicate that the bilirubin UDP-glucuronosyltransferase isozyme 1 UGT1A1 (TA)7/(TA)7 configuration is one of the factors responsible for hyperbilirubinemia.
24615032 DNA melting curve analysis is, therefore, an effective molecular method for the rapid diagnosis of Gilbert's syndrome, as it detects not only TATA-box polymorphisms but also the exon 1 G211A mutation located within the UGT1A1 gene.
24557078 Results show that Atazanavir-associated hyperbilirubinemia is best predicted by considering UGT1A1 genotype.
24519753 Data shows the UGT1A1*6 and UGT1A1*6/*28 genotypes were associated with an increased risk of irinotecan-induced neutropenia in Asian cancer patients.
24516079 Genotyping for UGT1A1*28 before initiation of antiretroviral therapy containing atazanavir may aid in identifying individuals at risk of hyperbilirubinaemia.
24458221 The study provided evidence that UGT1A1*28 polymorphism might be a genetic risk factor for the occurrence of chronic lymphocytic leukemia-specific abnormalities, trisomy 12 and del(11)(q22).
24453052 When the Uzbek and Japanese populations were compared, results show that heterozygotes or homozygotes for UGT1A1*28, UGT1A1*60, and UGT1A1*93 were significantly more frequent in the Uzbek population.
24403462 UGT1A1 polymorphisms are not associated with response to therapy in advanced colorectal cancer.
24403077 A higher neonatal death rate (57.1%) in hUGT1/Tlr2(-/-) mice was observed when compared with hUGT1 mice (8.7%).
24401909 These findings support the idea that UGT1A1-p.Q331X and UGT1A1 form a dimer and provide an increased mechanistic understanding of Crigler-Najjar syndrome type II.
24390949 Polymorphisms of the promoter region of the UGT1A1 gene was associated with idiopathic hyperbilirubinemia in Iranian neonates.
24375494 Flavonoids induce UGT1A1 gene expression via xenobiotic receptors in the intestines.
24341141 UGT1A1 mutations can cause Crigler-Najjar syndrome.
24329186 Increased dolutegravir exposure in carriers of UGT1A1 reduced function polymorphisms is not clinically significant based on accumulated safety data so dose adjustment in these individuals is not required.
24308720 Mutations in the UGT1A1 gene are associated with irinotecan induced neutropenia in Asians. [Meta-analysis]
24286076 Molecular analysis of the UGT1A1 gene can significantly help confirm the diagnosis of Crigler-Najjar syndrome , without any need for the liver biopsy.
24255116 Results suggest that CYP3A4 changes the catalytic function of the UGT1A subfamily in a UGT isoform-specific manner.
24232666 Disordered bilirubin conjugation through interactions of UG1TA1 gene variants contributes to the clinical phenotype of neonatal hyperbilirubinemia.
24217933 UGT1A1 allele 28 and ADH1C and B polymorphisms do not predict increased risk of hepatotoxicity during pegvisomant therapy
24204915 UGT1A1 (TA)7 allele as one of the factors accounting for the hyperbilirubinemia.
24195516 expression of CES2, UGTA1A1, and GUSB varies in colorectal pathology tissues and that the expression of CES2 is somewhat related to tumor staging.
24167350 Serum bilirubin levels associated with UGT1A1 promoter polymorphisms in children with sickle cell anemia.
24114122 UGT1A1 genotype affects the dose and pharmacokinetics of the CAPIRINOX regimen.
24107802 hyperbilirubinemia in patients treated with pazopanib or sunitinib may be benign manifestations of Gilbert's syndrome... UGT1A1 genotyping, would enable further characterization of liver safety risk and help in making treatment decisions.
24088753 Decreased activities of daily living and chronic cardiac disease are risk factors for drug-induced liver injury with increased bilirubin due to antitubercular drugs.
24088669 Homozygosity for UGT1A1*6/*6 and heterozygosity for UGT1A1*6/*28 were associated with an increased risk of absolute neutrophil count.
24065680 Molecular genetic analysis showed a homozygous UGT1A1 promoter mutation [A(TA)7TAA] and a heterozygous insertion of 1 adenosine nucleotide between positions 353 and 354 in exon 1 of UGT1A1 that caused a frameshift with a premature stop codon.
24060717 (TA)n in the UGT1A1 promoter and intensity of hemolysis modify steady-state serum bilirubin level in sickle cell disease
24057187 the TA repeat polymorphism of UGT1A1 is not associated with increased benign prostatic hypeplasia risk susceptibility in Caucasian men.
24033692 UGT1A polymorphisms, especially UGT1A1*6, are important for the prediction of severe toxicity of FOLFIRI in northeast Asian populations.
23992562 study reports causative UGT1A1 gene mutations in six Pakistani children born to consanguineous parents and suffering from nonhemolytic unconjugated hyperbilirubinemia
23981182 UGT1A1 TATA-box polymorphism is an important risk factor for developing jaundice in term breastfed newborns, presented as either early non-physiologic hyperbilirubinemia or breast milk jaundice.
23964438 The bilirubin UDP-glucuronosyltransferase gene polymorphism at nucleotide 211 (G71R) is an important risk factor for neonatal hyperbilirubinemia in Thai neonates.
23950218 a protective role of UGT1A1 expressed in the skin against neonatal hyperbilirubinemia.
23926009 Mutations of the UGT1A1 gene were found in 46 out of 61 patients with unconjugated hyperbilirubinemia.
23898114 pharmacogenetic study of UGT1A1 in a phase II study of irinotecan with 5'-deoxy-5-fluorouridine (5'-DFUR) for metastatic colorectal cancer
23892411 UGT1A1*28 polymorphism is associated with irinotecan response in colorectal cancer.
23881212 Weekly CPT-11 at 100 mg/m2 showed moderate response among gastric cancer patients; even after selection of patients by UGT1A1 polymorphism of *6, *27, and *28, severe toxic events could not be prevented completely
23789755 The presence of UGT1A1*28, UGT1A7*3, UGT1A9*22 genotypes decreases SN-38 clearance between 20 and 36%
23783485 UGT1A1*6 variant was closely associated with severe neutropenia both in gastric cancer and in esophageal cancer.
23781580 Patients with homotype UGTIAl1 alleles had a significantly lower glucuronidation ratio in comparison with UGTIAI wild-type and heterotype cases
23753274 UGT1A1 genotype explained variation in plasma bilirubin levels and was associated with increases in the plasma bilirubin level in GT heterozygotes and in TT homozygotes compared with GG homozygotes.
23714156 show gender-specific transcriptional control of UGT1A genes in jejunum and colon, which is repressed by ERalpha and the recruitment of HDCA 1 and 2 to the UGT1A promoter sequence in females
23686699 The overall incidence of UGT1A1 6 and UGT1A1 28 variants was 35.5 % and 21.0 %.
23647681 Multivariate regression analysis identified *28/*28 genotype, -4 CpG site methylation and alcohol history as significant predictors of UGT1A1 protein content.
23609856 suggest that UGT1A1 polymorphisms are important determinants of severe toxicity of nilotinib in Japanese patients
23605141 relative decreases in the SN-38G/SN-38 concentration ratio in patients homozygous for UGT1A1*6 and in double heterozygotes were greater than in patients heterozygous for UGT1A1*6 or UGT1A1*28
23580084 The low-expression UGT1A1*28(TA) 7 allele seems to be associated with decreased systemic exposure of the suspected muscle-toxic metabolite atorvastatin lactone.
23548653 Homozygosity of the UGT1A1*28 allele does not strongly predict the incidence of severe hyperbilirubinemia.
23537215 the UGT1A1 genotypes *1/*28 and *6/*28 as well as sex contributed to interindividual variations in the serum total-bilirubin levels in healthy young Japanese adults.
23529007 Although the toxicity relationships were much stronger with the UGT1A1*28 homozygous variant, associations were also found with the UGT1A1*28 heterozygous variant
23517300 data from Swedish twins confirm the Gilbert variant of UGT1A1 as a risk factor for gallstone disease.
23516488 UGT1A1*28 polymorphism cannot be considered as a reliable predictor of TR and PFS in CRC patients treated with IRI-based chemotherapy.
23461146 the Tunisian population appears to be heterogeneous view UGT1A1 gene mutation status
23401472 Resulting in the defective expression of UGT1A1 in the human kidney.
23386248 SNPs in UGT1A, other than UGT1A1*28, may influence irinotecan toxicity and should be considered to refine pharmacogenetic testing.
23350445 The individual differences in the adverse The responses to a popular antineoplastic agent, irinotecan, has been reputed to be related to UGT1A1 polymorphism.
23303296 Polymorphisms of the UDP-glucuronosyl transferase 1A genes are associated with adverse events in cancer patients receiving irinotecan-based chemotherapy.
23290513 Much of the observed unconjugated hyperbilirubinemia could be attributed to variation at the UGT1A1 locus, and UGT1A1 testing helped to substantiate a genetic diagnosis, thereby aiding in individual and family disease management
23236239 analysis of how a distinct distribution pattern of UGT1A1 genotypes in Chinese patients might contribute to relatively low toxicity associated with irinotecan and 5-fluorouracil in colorectal cancer patients
23207817 Comparison between patients and controls according to A(TA)nTAA variation demonstrated that (TA)(6)/(TA)(7) and (TA)(7)/(TA)(7) genotype and (TA)(7) and (TA)(8) alleles were significantly associated with an increased risk of gallstone diseases.
23148825 Co-immunoprecipitation assays showed that UGT1A1 lacking the SP (signal peptide) alone or also lacking the transmembrane domain (absent from i2) did not self-interact, but still interacted with i2
23148286 the UGT1A1*28 genotype was associated with an increased likelihood of hyperbilirubinemia in a large, prospective clinical trial and was associated with an increased likelihood of atazanavir/r discontinuation.
23147267 Individuals who carried the-53(TA)7,-3279G and-3156A mutant alleles of UDP-glucuronosyltransferase 1A1 in homozygous or heterozygous states had significantly higher mean serum bilirubin levels. Five major promoter haplotypes were observed.
23130636 LPS mediates the suppression of UGT1A1 expression through specific binding of NF-kappaB to this newly identified NF-kappaB-binding site in the upstream promoter of the UGT1A1 gene.
23089802 REVIEW: the transcriptional regulation of UGT1A1 by transcription factors and their co-factors, the genetic polymorphism associated with reduced transcriptional activity, and the induction of UGT1A1 expression by non-genetic factors
23053265 UGT1A1 polymorphisms were associated with toxicity and efficacy of irinotecan monotherapy in patients with advanced pancreatic cancer
23014115 Our study indicates that G71R mutation is a risk factor for neonatal hyperbilirubinemia only in infants with inadequate breastfeeding.
22829544 Roscovitine stimulated the expression of UGT1A1 by inhibiting CDK2, which phosphorylated PXR at Ser350 to suppress binding with RXR and coactivator and maintain the acetylation of PXR protein.
22808571 report of the varied effects of Gilbert syndrome (GS) in a Mexican Mestizo family with a non-common (TA)8 repeat in the promoter region of UGT1A1; report supports that the (TA)7 and (TA)8 are necessary, but not enough to explain the features of GS
22749334 Polymorphisms in UGT1A1 were associated with serum bilirubin levels in Chinese patients. Statins increased bilirubin levels and this effect was independent of the polymorphisms.
22676194 An individual's response to irinotecan is unlikely to be affected by UGT1A1*28 status.
22661630 The expression of UGT1A1 v2/v3 was 1.6-fold higher than v1 (p = 0.03) in HepG2 cells.
22648071 UGT1A1 is the principal enzyme responsible for puerarin metabolism in human liver microsomes.
22559977 results indicate that the UGT1A1*28 allele is a risk factor for colorectal cancer in the Macedonian male population, whereas no significant risk was detected among women
22537951 UGT1A1 Gly71Arg and G6PD gene mutations may be involved in the development of neonatal unconjugated hyperbilirubinemia.
22511988 The UGT1A1 enzyme catalyses the detoxification of several drugs and the turnover of many xenobiotic and endogenous compounds by glucuronidating its substrates.
22475179 Polymorphisms in genes encoding interleukin-10 and drug metabolizing enzymes GSTP1, GSTT1, GSTA1 and UGT1A1 influence risk and outcome in Hodgkin lymphoma.
22450351 Dual polymorphisms of UDP glucuronosyl-transferases 1A6 and 1A1 in a patient with Gilbert's syndrome who had persistent hyperserotoninemia that responded to octreotide are reported.
22448797 The UGT1A1*28/*28 genotype has emerged as an important element in drug tolerance, as well as in multifactorial diseases, such as cancer. [Review]
22398043 The homozygous state of the UGT1A1*28 polymorphism, associated with higher serum bilirubin levels, may be protective for the development of Crohn's disease, suggesting that the anti-oxidant capacity of bilirubin may play a part.
22371261 Pregnane x receptor serves to repress UGT1A1 gene expression during development.
22367021 The predicted high activity UGT1A1 genotype, associated with low serum levels of the antioxidant bilirubin, was associated with an increased esophageal squamous cell carcinoma risk.
22357454 HLA-positive breast cancer patients have higher alanine aminotransferase elevation and a higher incidence of Gilbert's syndrome.
22340355 A novel frame-shifting mutation of the UGT1A1 gene was found, confirming the diagnosis of Crigler-Najjar syndrome type I for this patient.
22325916 Alterations in the UGT1A1 coding region seem to be associated with increased bilirubin levels, and, therefore, with Gilbert syndrome.
22318545 The distribution of TPMT, UGT1A1 and MDR1 gene polymorphisms of the South Indian population was significantly different from other populations.
22307138 Study indicates that genotype status of UGT1A1, UGT1A9, and ABCC2 and serum bilirubin concentration increases reflect abnormally high AUC in patients treated with sorafenib.
22299209 nt 211 G > A alleles constitute at least 12% of UGT1A1 mutations underlying unconjugated hyperbilirubinemia
22273851 UGT1A1 polymorphisms are associated with development of head and neck cancers.
22214020 The relationship between UGT1A1 polymorphism and adverse effects of CPT-11 was examined through a review of the related studis.
22213983 UGT1A1 polymorphism was evaluated in relation to the efficacy and appropriate dosage of irinotecan to be used for the treatment of colorectal neoplasms.
22212955 UGT1A1*28 allele carrier status might be a protective factor against the development of CRC in the male population, whereas low serum bilirubin levels are associated with an increased risk of CRC in both genders.
22199302 SNPs (HSD17B1 (rs2010750, rs598126 and rs676387), COMT (rs4680), UGT1A1 (rs8175347) and ESR1 (rs9340799)) seem to be related to mammographic density in the same direction of their associations with breast cancer risk
22169899 A homozygous mutation in UGT1A1 exon 5 may be responsible for persistent hyperbilirubinemia.
22085899 UGT1A1 is a major locus influencing bilirubin levels and the results of this study promise to contribute to understanding of the etiology and treatment of hyperbilirubinaemia in African-ancestry populations.
22050734 the association between UGT1A1*28 allele and hyperbilirubinemia in HIV-infected individuals exposed to HAART
21983082 Breast milk reduces expression of intestinal UGT1A1, which leads to hyperbilirubinemia, which can be reduced by activation of pregnane X receptor, constitutive androstane receptor, or nuclear factor-kappaB.
21978357 we showed that heterozygous reduced-function *6 and *28 alleles appear to have no significant effect on plasma raltegravir concentrations in Japanese HIV-1-infected patients.
21911884 Microsatellite variations in the HMOX1 and UGT1A1 genes are not likely to protect from progression of liver disease in patients with chronic hepatitis C.
21771722 Repeat polymorphism in UGT1A1 is associated with Prostate Cancer.
21760472 Results showed that the c.-41_-40dupTA UGT1A1 allele (genetic), Hb, BMI and fasting time (nongenetic) were the main factors associated bilirubin levels.
21614935 UGTIA1 Gly71Arg may be a genetic factor of urine urobilinogen
21513526 rare UGT1A1 coding variants do not appear to play a prominent role in determining early bilirubin levels
21473286 The results obtained by quenching probe method were absolutely identical to those examined by the conventional direct sequencing. This method will enable point-of-care testing in clinical laboratories and patient-oriented therapy
21411679 UGT1A1*28 polymorphism had strong effects on bilirubin levels and the 7/7 genotype might have an important effect on reducing cardiovascular events and death in chronic hemodialysis patients.
21351260 Genetic polymorphism in the conjugating enzyme UGT1A1 is associated with head and neck cancer.
21342357 Meta-analysis suggests UGT1A1 Gly71Arg polymorphisms are a risk factor for neonatal hyperbilirubinemia in Asians but not Caucasians. UGT1A1 TATA promoter polymorphisms were associated with increased risk in Asians.
21319362 case report of heterozygous missense mutation (c.211G > A: p.G71R in exon 1) and homozygous for a point mutation (c.1456T > G: p.Y486D in exon 5) resulting in Crigler-Najjar syndrome type II
21317830 UGT1A1-53(TA)n polymorphism with L-thyroxine doses is associated with thyrotropin suppression in patients with differentiated thyroid cancer.
21275655 Prevalence of UGT1A1 gene polymorphism in patients with hemolytic anemia in southern Brazil
21272068 The UGT1A1 211G>A mutation is associated with neonatal hyperbilirubinemia in Asians, but not in Caucasians.
21266593 development of UGT1A1 and 1A6 was studied in 50 pediatric liver samples; data imply independent regulation of UGT1A1 and 1A6 where activity has matured after 6 months to 1 year
21150467 polymorphisms in UGT1A1*6 and UGT1A1*27 is associated with severe neutropenia in non-small cell lung cancer.
21092520 The G71R mutation was associated with neonatal jaundice in the Guangxi region.
21080475 Observational study of gene-disease association. (HuGE Navigator)
21072184 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20975617 Neonates who carry the nucleotide 211 GA or AA variation within coding region in UGT1A1 gene are more susceptible to develop early-onset neonatal breastfeeding jaundice.
20975617 Observational study of gene-disease association. (HuGE Navigator)
20948202 There was no evidence for a protective effect of the UGT1A1*28 polymorphism against ischemic stroke and consequently neither for bilirubin.
20948202 Observational study of gene-disease association. (HuGE Navigator)
20890421 The bilirubin uridine-diphosphoglucuronosyl transferase 1A1*28 allele frequency was 11%by direct sequencing of DNA from peripheral whole blood..
20890421 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20865252 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20860988 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20837016 Variants of ABCG8 and UGT1A1 are the 2 major risk factors for overall gallstone disease, they contribute a population attributable risk of 21.2% among men
20837016 Observational study of gene-disease association. (HuGE Navigator)
20823282 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20709051 Observational study of gene-disease association. (HuGE Navigator)
20686835 Letter: Results suggest that a small breast cancer risk conveyed by UGT1A1 and UGT1A6 variants may be further amplified by the experience of persisting stressful events.
20686835 Observational study of gene-disease association. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20653675 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20650040 G71R mutation of UGT1A1 gene is present in Turkish population and the presence of this mutation is associated with otherwise unexplained pathological or prolonged neonatal hyperbilirubinemia in a Turkish population
20650040 Observational study of gene-disease association. (HuGE Navigator)
20648548 These data indicate that major dietary fatty acids and vitamin E are differentially and selectively able to affect the expression of genes involved in lipid metabolism.
20647221 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20643254 Polymorphisms in UGT1A1 were not associated with a response to metoprolol or carvedilol therapy in our cohort of patients with heart failure. The ADRB1 and CYP2D6 genotype, alone and in haplotype, were significantly associated with the dose of carvedilol.
20643254 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20639394 Genetic variations of SLCO1B3 and UGT1A1 is associated serum bilirubin levels in Korean population.
20639394 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628391 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20620155 These findings suggest that the enzymatic properties of human and cynomolgus monkey UGT1A1 enzymes are very similar.
20600030 UGT1A genes are induced in vitro and in vivo by coffee, independent of caffeine content, cafestol, or kahweol.
20580994 Significant correlations were observed between SN-38G formation rates in the presence of erlotinib and UGT1A1*28 which suggests that adverse effects of the combination of irinotecan with erlotinib would be associated with UGT1A1*28 polymorphism.
20580994 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20562445 Despite a strong gene-dosage effect on bilirubin levels in both cases and referents, the UGT1A1*28 polymorphism did not influence the risk of myocardial infarction.
20562445 Observational study of gene-disease association. (HuGE Navigator)
20562211 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20546738 Lentiviral vectors that express UGT1A1 reduce hyperbilirubinemia in immunocompetent Gunn rats for at least 6 months. The immune response against virally expressed UGT1A1 can be circumvented by inclusion of miR-142 target sequences.
20530282 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20529348 There is a combined effect of regulatory polymorphisms on the transcription of UGT1A1 that is necessary in causing Gilbert syndrome.
20528568 Observational study of gene-disease association. (HuGE Navigator)
20528217 G71R mutation of UGT1A1 is not rare; however, an association between G71R mutation and hyperbilirubinemia of unexplained cause has not been shown in Turkish newborns.
20528217 Observational study of gene-disease association. (HuGE Navigator)
20504240 The MDR1 G2677T/A variation and UGT1A1*28 are independent risk factors for severe atazanavir-associated hyperbilirubinemia in Korean human immunodeficiency virus-infected patients.
20504240 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20483464 This study demonistrated that schizophrenia patients with ugt1a1 genotype had markrdly lower serum bilirium.
20483464 Observational study of gene-disease association. (HuGE Navigator)
20430047 Observational study of gene-disease association. (HuGE Navigator)
20402064 Both TA7/7 and TA6/7 promoter polymorphisms in the UGT1A1 gene were found as risk factors in Turkish newborns with significant hyperbilirubinemia of unknown etiology or DC(-) ABO incompatibility.
20402064 Observational study of gene-disease association. (HuGE Navigator)
20389299 UGT1A1 repeat polymorphism is frequently associated with pazopanib-induced hyperbilirubinemia
20389299 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20385995 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20381444 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20378551 Golgi N-glycosyltransferases beta-1,2-N-acetylglucosaminyltransferase I, beta-1,2-N-acetylglucosaminyltransferase II, 1,4-galactosyltransferase I, and alpha-2,6-sialyltransferase I form both homo- and heterodimeric enzyme complexes in live cells
20377135 the UGT1A1*28 genotype is not associated with the severe toxicity of low-dose irinotecan in patients with lung cancer.
20377135 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20376058 Observational study of gene-disease association. (HuGE Navigator)
20371435 report describes 2 patients diagnosed with hereditary hemochromatosis hospitalized because of liver damage; rare variant forms of UGT1A1 gene coexisting with HFE gene mutations were discovered
20358470 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20335017 patients carrying UGT1A1*28 allele(s) are at an increased risk of irinotecan-induced severe diarrhoea only apparent in those who are administrated with medium or high irinotecan doses.
20335017 Meta-analysis of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20308029 TA repeat polymorphism of UGT1A1 gene does not seem to alter prostate cancer risk susceptibility in Caucasian men
20308029 Observational study of gene-disease association. (HuGE Navigator)
20297805 The results also indicated that UGT1A1, UGT1A7, UGT1A8, UGT1A9, UGT1A10 and UGT2B7 are the most important six UGT isoforms for metabolizing the three dihydroxyflavones and seven monohydroxyflavones.
20235787 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20216541 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20215562 bilirubin binding site, known pathological mutations in UGT1A1, and other specific residues have been examined in the context of the model with regard to available experimental data
20214802 Observational study of gene-disease association. (HuGE Navigator)
20207827 UGT1A1*28 genotype and male gender predict an increased incidence of liver function test abnomalities during pegvisomant therapy in acromegaly.
20207827 Observational study of gene-disease association. (HuGE Navigator)
20197307 Data observed that OSM positively augmented the CAR and UGT1A1 expressions and CAR-mediated signaling in vivo and in vitro, through cross talk between the nuclear CAR receptor and the plasma membrane OSM receptor, via the MAPK cascade.
20177420 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20173083 Observational study of genotype prevalence. (HuGE Navigator)
20142249 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20136364 Observational study of genetic testing. (HuGE Navigator)
20096102 UGT1A1 expression in colon cells is positively regulated by HNF1-alpha and USF, and negatively regulated by DNA methylation.
20087647 Polymorphisms in UGT1A1 gene is associated with breast cancer.
20087647 Meta-analysis of gene-disease association. (HuGE Navigator)
20070246 UGT1A1 is associated with Gibert's syndrome characterized by mild unconjugated nonhemolytic hyperbilirubinemia.
20064729 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20063115 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20061399 variants of UGT1A1 were not associated with severe hyperbilirubinemia in a sample of newborns in Brazil
20061399 Observational study of gene-disease association. (HuGE Navigator)
20057336 Observational study of gene-disease association. (HuGE Navigator)
20038727 In patients with metastatic colorectal cancer the recommended dose of 180 mg/m(2) for irinotecan in FOLFIRI is considerably lower than the dose that can be tolerated when patients with the UGT1A1*28/*28 genotype are excluded.
20038727 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20028383 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19996319 Data show that protein-protein interactions are likely responsible for the inhibition of active UGT1A_i1 by i2 spliced polypeptides.
19948621 Variant UGT1A1*6 genotypes are associated with a lower risk of NAFLD in obese Taiwanese children. The UGT1A1 genotype is a new risk factor for pediatric NAFLD.
19948621 Observational study of gene-disease association. (HuGE Navigator)
19932091 Observational study of genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19891553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19888426 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19861894 UGT1A1 promoter genotype is not a major factor contributing to risk of coronary artery disease.
19861894 Observational study of gene-disease association. (HuGE Navigator)
19859999 UGT1A1 gene polymorphism has a role in toxicity and efficacy of irinotecan-based regimens in metastatic colorectal cancer
19859999 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19858398 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19858149 coexpression of the G6PD African A- mutation with UGT1A1 and/or SLCO1B1 variants was seen more frequently in neonatal hyperbiliruinemia
19858149 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19830808 In 19 Crigler-Najjar syndrome patients diagnosed in The Netherlands, we have identified 14 different UGT1A1 mutations, four of which are novel, and correlated the genotype with phenotype, and determined functional activity of the 10 missense mutations.
19797611 The expression of UGT1A1 and CYP2B6 is negatively regulated through a CDK2 signaling pathway linked to cell cycle progression in HepG2 and SW480 cells, the mechanism of which may differ from that of CYP3A4 expression through PXR phosphorylated by CDK2.
19771428 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19732760 Two UGT1A1 promoter polymorphisms (-53(TA)(6/7) and c.-3279T>G) and a common haplotype of the UGT1A1 gene are associated with serum bilirubin concentrations in Caucasians
19732760 Observational study of gene-disease association. (HuGE Navigator)
19712005 Data identified five different genotypes in UGT1A1, demonstrating a high variability of alleles and haplotypes, which have important roles in modifying expression and activity of UGTs.
19683255 Observational study of gene-disease association. (HuGE Navigator)
19674361 Homozygous variant of nucleotide 211 G--A mutation of UGT1A1 gene is a significant risk factor associated with severe hyperbilirubinemia among Malayasian Chinese newborns.
19674361 Observational study of gene-disease association. (HuGE Navigator)
19639031 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19636001 Observational study of genotype prevalence, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19620808 Analysis of the UGT1A1 gene polymorphism after symptom improvement revealed UGT1A1(*)28 homozygosity in both cases.When FOLFIRI is conducted, particular attention must be paid to the presence of this polymorphism.
19546880 Observational study of genotype prevalence. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19513514 Examine role of UGT1A1 polymorphisms in patient response to gastric cancers treated with FOLFOX or FOLFIRI.
19486253 Uridine diphosphate glucuronosyl transferase 1A1 promoter polymorphism is associated with choledocholithiasis in Taiwanese patients.
19486253 Observational study of gene-disease association. (HuGE Navigator)
19482841 Observational study of gene-disease association. (HuGE Navigator)
19450125 UGT1A1 genotyping is not a good predictor of hematological toxicity in patients treated with intermediate irinotecan doses, but it may be useful in the identification of patients at risk of severe diarrhea.
19430380 Data show that (TA)n promoter polymorphism of the UGT1A1 gene was significantly associated with hyperbilirubinemia in North Indian neonates.
19430380 Observational study of gene-disease association. (HuGE Navigator)
19424794 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19419973 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19414484 Genetic variation of UGT1A1 and SLCO1B1 is associated with the total serum bilirubin levels.
19414484 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19406951 Characterizing the effects of common UDP glucuronosyltransferase (UGT) 1A6 and UGT1A1 polymorphisms on cis- and trans-resveratrol glucuronidation.
19406951 Observational study of gene-disease association. (HuGE Navigator)
19397531 Observational study of gene-disease association. (HuGE Navigator)
19390945 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19389676 Our studies suggest that UGT1A1 may be the major gene with strong effects on bilirubin levels and the TA-repeat polymorphism might be the key polymorphism within the gene controlling bilirubin levels.
19371317 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19364970 UGT1A variants additional to UGT1A1*28 might improve the prediction of the outcome of colorectal cancer patients treated with FOLFIRI.
19364970 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19356098 This is the first report showing direct induction of UGT1A1 by a bilirubin through AhR pathway.
19352303 We did not observe significant associations between individual single nucleotide polymorphisms and UGT1A1 haplotypes and endometrial cancer risk
19352303 Observational study of gene-disease association. (HuGE Navigator)
19349543 UGT1A1 (G-3156A)A/A (drug metabolism) was associated with irinotecan plus cisplatin-related neutropenia.
19349540 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19343046 single-nucleotide polymorphisms in UGT1A1 gene is associated with variations in serum total bilirubin levels.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19336732 Within each UGT1A1 genotype, lower bilirubin concentrations were seen in both single- and double-dose cruciferous diets
19336732 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19325249 The G71R mutation may account for the increased incidence of neonatal jaundice seen in Asian populations.
19325249 Observational study of gene-disease association. (HuGE Navigator)
19309288 Observational study of gene-disease association. (HuGE Navigator)
19303655 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19299905 Genetic Polymorphisms in UDP glucuronosyltransferase 1A1 is associated with toxicities of combination chemotherapy with irinotecan and cisplatin in gynecologic cancers.
19299905 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19279563 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19268007 Study has proven bilirubin level correspond to interaction of c.-3279T>G and A(TA)7TAA variants in UGT1A1 gene.
19268007 Observational study of gene-disease association. (HuGE Navigator)
19243019 Study indicated that the (TA)n repeat polymorphism and SNP rs4148323:G4A of UGT1A1 were associated with serum total bilirubin levels in all three Asian populations.
19243019 Observational study of gene-disease association. (HuGE Navigator)
19238116 Observational study of gene-disease association. (HuGE Navigator)
19217809 A child and her parents were found to have a new mutation in exon 1. This novel gross c.609_632del mutation predictably gives rise to an internally deleted polypeptide (p.His203_Lys211delinsGln).
19207584 Observational study of gene-disease association. (HuGE Navigator)
19204906 Observational study of genotype prevalence. (HuGE Navigator)
19141701 This study reports that citrus consumption may increase UGT1A1 activity among women with the 7/7 genotype.
19141701 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19077918 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19021734 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18990750 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18982743 Observational study of gene-disease association. (HuGE Navigator)
18981166 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18953066 Prospective evaluations of genetic testing for UGT1A1 polymorphisms appear to be warranted, especially in East Asian countries
18832463 Observational study of genetic testing. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18797458 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18790042 Observational study of gene-disease association. (HuGE Navigator)
18781851 The c.-3279T>G variant in the UDP-glucuronosyltransferase (UGT)1A1 gene is a further factor for development of hyperbilirubinemia in the Taiwanese population.
18781851 Observational study of gene-disease association. (HuGE Navigator)
18768784 UGT1A1 polymorphism on TA repeats, which are thought to determine several anticancer drugs metabolism, influence Hodgkin lymphoma patient outcome.
18768784 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18756540 UGT1A1 promoter polymorphisms and the development of hyperbilirubinemia and gallbladder disease in children with sickle cell anemia are reported.
18756540 Observational study of gene-disease association. (HuGE Navigator)
18695635 In a study of Japanese renal transplant recipients, UGT1A1 I399C/T polymorphisms do not contribute significantly to interindividual variability for mycophenolic acid glucuronide biotransformation from MPA.
18685565 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18675828 UGT1A1-3279 GG/TG intermediate/low activity genotypes were associated with an increased risk of colon cancer (odds ratio (OR)=1.5, 95% confidence interval (CI)=1.1-2.0) in Caucasians.
18675828 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18597651 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18594531 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18558634 Gene polymorphisms of UGT1A1 gene were detected in children with hereditary hyperbilirubinemia; degree of genetic heterogeneity and variant coexpression across UGT1A1 genes points to polygenic nature of neonatal hyperbilirubinemia.
18558634 Observational study of genotype prevalence. (HuGE Navigator)
18547414 Observational study of genetic testing. (HuGE Navigator)
18509181 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18498916 significantly higher proportion of MPA AUC measurements in recipients carrying the UGTIA9 T-275A and/or C-2152T SNP were in the low MPA exposure range.
18491077 Role in Gilbert's syndrome (Review)
18454993 UGT polymorphisms may be a factor influencing clinical outcomes among patients receiving mycophenolate mofetil for transplant therapy.
18430559 UGT1A1 and UGT1A9 activity in human liver are affected by soyabean isoflavones genistein and daidzein
18419642 A missense mutation of Tyr486Asp in the UGT1A1 gene is considered to be the cause of the Crigler-Najjar syndrome type II in this patient. It is a recessive trait that is autosomally inherited in this family.
18392554 the UGT1A1 promoter polymorphism may represent an important nonglobin genetic modifier of Bantu sickle cell disease patients' clinical manifestations, even at a young age
18392554 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18379174 Polymorphisms within the gene are markers for personalized irinotecan therapy in Japanese cancer patients.
18375480 This study of patients with intermittent claudication and control individuals revealed a clear association between low bilirubin concentrations and peripheral arterial disease but no association between the UGT1A1 polymorphism and the disease.
18375480 Observational study of gene-disease association. (HuGE Navigator)
18349289 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18349273 The G/G genotype (rs2070959) in the UGT1A1 gene may decrease the risk of endometrial cancer in women with low levels of endogenous estrogen or with low soy intake.
18349273 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18343383 less cardiovascular risk in individuals with Gilbert syndrome (GS) as well as those with the UGT1A1*28 allele
18335219 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18324905 Observational study of gene-disease association. (HuGE Navigator)
18300238 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18240903 Observational study of genotype prevalence. (HuGE Navigator)
18223459 Observational study of genotype prevalence. (HuGE Navigator)
18221820 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18181169 Docosahexaenoic acid and vitamin E resulted to affect only slightly UDP-glucuronosyltransferase 1A1 (UGT1A1) mRNA expression. Nevertheless, their combination produced a considerable reduction of this mRNA.
18172616 HNF1alpha bound to the proximal promoter motif enhances basal reporter activity of UGT1A1, including distal (-3570/-3180) and proximal (-165/-1) regions, and influences transcriptional regulation of UGT1A1 by CAR, PXR, GR, and AhR
18161889 Observational study of gene-disease association. (HuGE Navigator)
18082937 UGT1A1*6 polymorphism is associated with irinotecan toxicities in cancer
18082937 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18081723 combined TATA-box variants and G71R mutations of the UGT1A1 is associated with cholelithiasis in beta-thal/hemoglobin E
18081723 Observational study of gene-disease association. (HuGE Navigator)
18052087 UGT1A7, UGT1A8, and UGT1A9 were mainly responsible for formation of prunetin-5- O-glucuronide; UGT1A1, UGT1A8, and UGT1A10 were mainly responsible for formation of prunetin-4'- O-glucuronide; thermostability of microsomes was isoform- and organ-dependent
18043502 High frequency of UGT1A1 promoter polymorphism, coupled with G-6-PD deficiency, may contribute to the pathogenesis of extreme neonatal hyperbilirubinemia in Nigeria.
18004206 The glucuronidation of all UGT1A1 substrates is likely to be impaired in subjects carrying the UGT1A1*6 and UGT1A1*62 alleles, although the reduction in metabolic clearance might vary with the substrate.
17990575 role in neonatal hyperbilirubinemia and kernicterus [review]
17981384 UGT1A1 over-expression could protect against xenobiotic assault.
17978490 UGT1A1 prefers metabolizing R-carvedilol to S-carvedilol. A G71R mutation of UGT1A1 reduced both affinity and capacity but did not affect stereoselective metabolism.
17952380 Although the concentration of bilirubin in the UGT1A1 variant is higher than the wild type for the patients with coronary disease (CAD), there is no significant difference in the polymorphism between the patients and the participants in the control group.
17949292 Observational study of gene-disease association. (HuGE Navigator)
17949292 the role of the above genetic variation at the UGT1A1 locus in breast cancer susceptibility was investigated in a homogeneous population.
17909964 the role of UGT1A1 in breast cancer development may vary by population
17909964 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17898154 Determine drug metabolism by human liver microsomes genotype for UGT1A1 polymorphisms.
17888052 Observational study of gene-disease association. (HuGE Navigator)
17888052 Finds the UGT1A1 gene codon G71R allele is a risk factor for neonatal hyperbilirubinemia in the Chinese population
17850628 Observational study of gene-disease association. (HuGE Navigator)
17850628 UGT1A1 and UGT1A7 variant alleles are associated with increased risk of Gilbert's syndrome in Taiwanese adults
17762398 Observational study of genotype prevalence. (HuGE Navigator)
17728214 Meta-analysis of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17700594 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17681105 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17681105 Increased frequency of uridine diphosphate glucuronosyltransferase 1A1 7/7 in patients experiencing severe irinotecan-induced toxicities
17627617 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17622938 The aims of this study were to determine the L-thyroxine (T4) glucuronidation ability of human UGTs, and investigate the relationship between genetic polymorphisms in UGT1A1 and UGT1A9 and T4 glucuronidation in human livers.
17611564 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17611564 a UGT1A1 promoter polymorphism increases risk of nilotinib-induced hyperbilirubinemia
17593033 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17578897 The key residues within the nucleotide-sugar binding site of UDPGT were identified.
17577039 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17576806 5-(4'-Hydroxyphenyl)-5-phenylhydantoin O-glucuronide formation in human liver microsomes is catalyzed by UGT1A1, UGT1A9, and UGT2B15 in a stereoselective manner
17558305 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17558305 Associations between UGT1A haplotypes and pharmacokinetics/pharmacodynamics of irinotecan were investigated to identify pharmacogenetic markers.
17555467 these data indicate only a partial (approximately 40%) contribution of the UGT1A1*28 polymorphism to variability of interindividual differences in UGT1A1 enzyme activity.
17549067 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17530442 PBREM has no relation with the induction by dexamethasone-glucocorticoid receptor (GR) but the proximal site of UGT1A1 may function in stimulation by dexamethasone-GR
17510208 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17510208 UGT1A1 promoter polymorphisms have a role in response by colon cancer to treatment with irinotecan
17506482 Observational study of genetic testing. (HuGE Navigator)
17498780 Observational study of gene-disease association. (HuGE Navigator)
17478602 Observational study of gene-disease association. (HuGE Navigator)
17478602 The correlation of UGT1A1 with total bilirubin levels was mainly due to (TA)(n) repeats in Caucasians but a clear correlation was not observed in African Americans because of the high diversity of haplotypes and the small sample size.
17471158 Observational study of genetic testing. (HuGE Navigator)
17459361 Observational study of genetic testing. (HuGE Navigator)
17440429 Provide evidence for HNF1alpha as a determinant of UGT1A1 mRNA expression, but suggest a role for multiple transcription factors.
17426648 Observational study of gene-disease association. (HuGE Navigator)
17426648 in the steady state, similar rates of hemolysis, but increased plasma total bilirubin (PTB)in the glucose-6-phosphate dehydrogenase deficient, (TA)7/(TA)7 homozygotes, imply that (TA)7/(TA)7, homozygosity is central to increased PTB
17409981 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17406868 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17374650 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17374650 Serum bilirubin glucuronidation is modulated by dietary intervention, but factors such as UGT1A1 genotype and sex may affect the response to diet.
17372243 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17329852 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17273745 Observational study of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17273745 genetic polymorphisms of UGT1A as a prognostic factor in advanced colorectal cancer patients treated with 5-fluorouracil plus oxaliplatin or irinotecan.
17259171 Nrf2-Keap1-dependent UGT1A1 induction by prooxidants might represent a key adaptive response to cellular oxidative stress
17229650 analysis of new pathogenic variations of the UGT1A1 gene in patients with neonatal unconjugated hyperbilirubinemia
17196409 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17196409 the frequency of UGT1A1(TA)n promoter polymorphism genotypes, including the extremely rare (TA)8 allele, was determined for the first time in the Slovenian population and is similar to frequencies observed in other Caucasian populations
17192505 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17187418 Results indicate that alternative splicing mechanism at the UGT1A locus amplifies the structural diversity of human UGT proteins and describes the identification of an additional posttranscriptional regulatory mechanism of the glucuronidation pathway.
17185998 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17166930 Observational study of gene-disease association. (HuGE Navigator)
17138857 Observational study of gene-disease association. (HuGE Navigator)
17060921 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17060921 Genetic heterogeneity in UGT1A1 in Chinese populations may be linked to development of irinotecan toxicity and hyperbilirubinemias.
17000907 Observational study of gene-disease association. (HuGE Navigator)
16985250 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16969497 analysis of the linkage disequilibrium of UGT1A1 *6 and UGT1A1 *28 in relation to UGT1A6 and UGT1A7 polymorphisms
16965601 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16951398 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16909274 Observational study of gene-disease association. (HuGE Navigator)
16896007 We could not confirm the relationships between ABCB1 and UGT1A1 polymorphisms and Ir PK.
16871576 In human hepatic cells and human UGT1A transgenic mice, LXRalpha activators induce UGT1A3 mRNA levels and the formation of CDCA-24glucuronide (24G) and LCA-24G.
16865249 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16864595 Observational study of gene-disease association. (HuGE Navigator)
16849011 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16809730 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16792515 Observational study of gene-disease association. (HuGE Navigator)
16791115 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16771603 Observational study of genotype prevalence. (HuGE Navigator)
16735790 Kernicterus associated with hereditary spherocytosis and UGT1A1 promoter polymorphism.
16712705 combinations of mutations in the UGT1A1 gene play a role in development of Crigler-Najjar type II syndrome
16637266 Observational study of gene-disease association. (HuGE Navigator)
16636344 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16610035 Observational study of gene-disease association. (HuGE Navigator)
16609363 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16609363 For Thai HIV-infected patients treated with indinavir, the promoter polymorphism (UGT1A1*28) is of less significance than the coding region (UGT1A1*6) mutation as a risk factor for hyperbilirubinemia.
16557566 Observational study of gene-disease association. (HuGE Navigator)
16557566 Gilbert UGT1A1 allele increases the risk of gallstone formation in cystic fibrosis(CF). Genetic and exogenous sources contributing to hyperbilirubinbilia might be lithogenic in CF patients.
16513443 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16469709 A Chinese Han nationality family suffered from Gilbert's syndrome was studied and it was inferred that the disease was caused by mutation in the open reading frame of the gene UGT1A1.
16456808 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16424820 analysis of the genetic determinants of UGT1A1 inducibility by phenobarbital in cultured human hepatocytes
16399345 Regulation of the UGT1A1 gene by Nuclear receptors is studied.
16280036 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16257926 Observational study of gene-disease association. (HuGE Navigator)
16257834 Observational study of gene-disease association. (HuGE Navigator)
16255851 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16237771 Observational study of gene-disease association. (HuGE Navigator)
16237771 homozygous variation in the UGT1A1 gene is a risk factor for the development of cholelithiasis in Taiwan Chinese
16210851 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16171463 Free thiol groups of 7 cysteine residues within the intracisternal region of human UGT1A1 are important for its catalytic activity, while cysteine residues in the cytosolic domain may be involved in its physiological activation by UDP-GlcNAc.
16135700 There is a differential induction of UGT1A1 by chrysin in primary hepatocytes and HepG2 cells.
16004608 Serum bilirubin was significantly higher in the homozygous (AT)7 UGT1A1 allele group
15931768 Observational study of genotype prevalence. (HuGE Navigator)
15929176 Observational study of gene-disease association. (HuGE Navigator)
15929176 carriage of the UGT1A7*3 allele, as well as variant-211 UGT1A1 allele represents a risk factor for the development of, and a determinant for, metastases associated with colorectal cancer patients
15867280 Individuals with decreased UGT1A1 activity due to the 7/7 genotype may be at greater risk for carcinogenesis, they also may have greater opportunity to decrease that risk through dietary intervention such as the addition of vegetables.
15864130 Observational study of genotype prevalence. (HuGE Navigator)
15864125 Observational study of gene-disease association. (HuGE Navigator)
15864125 UGT1A1, OATP2 and G6PD genes have roles in genetic predisposition to unconjugated hyperbilirubinemia
15864124 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15864124 polymorphism in the phenobarbital-responsive enhancer module of the UGT1A1 gene has a role in response to irinotecan and its toxicity
15857854 Observational study of gene-disease association. (HuGE Navigator)
15857854 UGT1A1 promoter repeat polymorphism is associated with Childhood acute lymphoblastic leukemia
15855726 Observational study of gene-disease association. (HuGE Navigator)
15771689 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15771689 the -3263T>G MUTATION IS NOT LIKELY TO BE ASSOCIATED WITH THE NEONATAL HYPERBILIRUBINEMIA IN JAPANESE.
15746053 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15712364 Novel mutations, considered pathogenic, including 1 nonsense mutation, 2 altered splice sites, 1 single-base deletion & 9 missense mutations were found in coding exons & flanking introns. Several new missense mutations are in critical domains.
15710570 Observational study of gene-disease association. (HuGE Navigator)
15710570 the UGT1A1 gene promoter polymorphism may have a role in cholelithiasis in sickle cell anemia patients
15709212 It is the enzyme responsible for glucuronidation of SN-38 to form less toxic, inactive metabolite SN38G.
15684703 Nonviral gene transfer of UGT1A1 into Gunn rat liver and muscle corrected hyperbilirubinemia.
15572581 Observational study of genotype prevalence. (HuGE Navigator)
15560369 dexamethasone directly and/or indirectly stimulates UGT1A1 expression through the HNF1 region in the promoter region of UGT1A1
15557560 results demonstrate a rational mechanistic basis for UGT1A1 induction by glucocorticoids and PXR activators, showing that activated glucocorticoid receptor enhances CAR/PXR-mediated UGT1A1 regulation with the transcriptional cofactor GRIP1
15523087 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15519273 Observational study of gene-disease association. (HuGE Navigator)
15491385 Observational study of genotype prevalence. (HuGE Navigator)
15472229 detected in the endometrium are involved in the glucuronidation of E(2) and its 2-OH, 4-OH, and 2-MeO metabolites
15455371 Observational study of gene-disease association. (HuGE Navigator)
15388579 Observational study of gene-disease association. (HuGE Navigator)
15388579 TA)(7)/(TA)(7) genotype may be a risk factor for symptomatic gallstones in older people with sickle cell disease.
15320866 in liver microsomes, UGT1A1 is primarily responsible for farnesol glucuronidation; however, in intestine microsomes, UGT2B7 is probably the major isoform involved
15319464 neonates who carry the 211 and 388 variants in the UGT1A1 and OATP 2 genes, respectively, as well as feed with breast milk are at high risk to develop severe hyperbilirubinemia.
15319294 Observational study of gene-disease association. (HuGE Navigator)
15318931 Observational study of gene-disease association. (HuGE Navigator)
15304120 Observational study of gene-disease association. (HuGE Navigator)
15297419 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15297419 the UGT1A1 polymorphisms in colorectal cancer may play a role in patient toxicity after irinotecan
15286088 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15280927 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15254716 Observational study of gene-disease association. (HuGE Navigator)
15254716 UGT1A1 could have a role in the development of specific histologic sub-groups of ovarian cancer
15247627 Observational study of gene-disease association. (HuGE Navigator)
15180166 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15179405 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15111762 Observational study of genotype prevalence, gene-disease association, and gene-environment interaction. (HuGE Navigator)
15111762 *28 allele in the UGT1A1 gene may be associated with an increased risk for breast cancer among Chinese women under age 40.
15049432 Observational study of pharmacogenomic / toxicogenomic and genetic testing. (HuGE Navigator)
15007088 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14871858 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14647407 Observational study of gene-disease association. (HuGE Navigator)
14647407 The TA repeat polymorphism in UGT1A1, which predisposes some individuals to Gilbert's syndrome, predicts the susceptibility to tranilast-induced hyperbilirubinemia.
14616765 We analyzed the bilirubin UDP-glucuronosyltransferase gene in a female Chinese patient with Crigler-Najjar syndrome type I.
14586211 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14555305 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14550264 a translocation-deficient UGT1A1 protein is involved in Crigler-Najjar syndrome
12972027 4% of males in the Kuwaiti population have G6PD deficiency coexisting with low activity of the UDPGT1 promoter
12969965 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12960109 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12850492 Observational study of genotype prevalence. (HuGE Navigator)
12850481 Observational study of gene-disease association. (HuGE Navigator)
12850481 investigated the contribution of the A(TA)(7)TAA/A(TA)(7)TAA genotype in the promoter region of the UGT1 A1 gene in the variable unconjugated serum bilirubin levels in patients with thalassemia and sickle cell anemia.
12800608 genetic variation in genes involoved in the disposition of anticancer agents might alter patient't outcome.
12743455 Observational study of gene-disease association. (HuGE Navigator)
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12732365 Observational study of genotype prevalence. (HuGE Navigator)
12732365 Frequent haplotypes containing several UGT1 allelic variants should be taken into account in studies on the association between diseases, abnormal drug reactions, and UGT1 family polymorphisms.
12680285 Observational study of gene-disease association. (HuGE Navigator)
12677174 Observational study of gene-disease association. (HuGE Navigator)
12677174 The UGT1A promoter polymorphism is a powerful nonglobin genetic modifier in Sickle Cell Anemia that influences serum bilirubin both at baseline and on hydroxyurea therapy.
12646172 human bilirubin UDP-glucuronosyltransferase requires phosphorylation for activity
12602902 Observational study of gene-disease association. (HuGE Navigator)
12566446 UGT1A1 induction by ligand binding to the Ah receptor was regionalized to a UGT1A1 enhancer region containing a xenobiotic response element (XRE) at -3381/-3299
12502904 Observational study of gene-disease association. (HuGE Navigator)
12499798 Observational study of gene-disease association. (HuGE Navigator)
12480568 Crigler Najar syndrome and Gilbert syndrome caused by deficiency in hepatic glucuronidation of bilirubin resulting from mutation of UGTqA1 gene. (review)
12480553 Observational study of gene-disease association. (HuGE Navigator)
12480553 Most patients with Gilbert's syndrome may have abnormalities in glucuronidation of aspirin or coumarin- and dopamine-derivatives, due to this combination of UGT1A1*28 and UGT1A6*2 genotypes.
12439228 Observational study of gene-gene interaction. (HuGE Navigator)
12357057 Observational study of gene-disease association. (HuGE Navigator)
12185559 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12151360 induction in cultured tumor cells by sulforaphane and its glutathione conjugate
12105841 Observational study of gene-disease association. (HuGE Navigator)
12105841 results indicate that carriage of the homozygous 211 G to A variation within the coding region is an additive risk factor for neonatal hyperbilirubinemia in G6PD-deficient Taiwanese male neonates.
12078936 Observational study of gene-disease association. (HuGE Navigator)
12036456 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11987245 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
11915038 Observational study of gene-disease association. (HuGE Navigator)
11906189 Observational study of gene-disease association. (HuGE Navigator)
11906189 polymorphism in the UGT1A1 gene promoter and its association with hyperbilirubinemia
11878580 Observational study of gene-disease association. (HuGE Navigator)
11878580 Polymorphisms in UGT1A1 causes cholelithiasis and a modifier of bilirubin metabolism
11857560 Observational study of genotype prevalence. (HuGE Navigator)
11857560 The high frequencies of (TA)(7) polymorphism among the three groups confirm previous data that this polymorphism is very ancient and appears to be distributed throughout the world.
11855932 A novel G > A mutation at the splice acceptor site in intron 4, causing Crigler-Najjar syndrome type 1
11827650 Observational study of gene-disease association. (HuGE Navigator)
11764096 Observational study of gene-disease association. (HuGE Navigator)
11401924 Observational study of gene-disease association. (HuGE Navigator)
11156391 Observational study of gene-environment interaction. (HuGE Navigator)
11141380 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MAVESQGGRPLVLGLLLCVLGPVVSHAGKILLIPVDGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRD      1 - 70
GAFYTLKTYPVPFQREDVKESFVSLGHNVFENDSFLQRVIKTYKKIKKDSAMLLSGCSHLLHNKELMASL     71 - 140
AESSFDVMLTDPFLPCSPIVAQYLSLPTVFFLHALPCSLEFEATQCPNPFSYVPRPLSSHSDHMTFLQRV    141 - 210
KNMLIAFSQNFLCDVVYSPYATLASEFLQREVTVQDLLSSASVWLFRSDFVKDYPRPIMPNMVFVGGINC    211 - 280
LHQNPLSQEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTI    281 - 350
LVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTS    351 - 420
EDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLD    421 - 490
VIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH                               491 - 533
//

Text Mined References (581)

PMID Year Title
27264814 2016 [Genetic analysis of a child affected with Crigler-Najjar syndrome type II].
26857783 2016 Effects of UGT1A1*6, UGT1A1*28, and ABCB1-3435C>T polymorphisms on irinotecan induced toxicity in Chinese cancer patients.
26773202 2016 UGT genotyping in belinostat dosing.
26751466 2016 Association between UGT1A1 Polymorphism and Risk of Laryngeal Squamous Cell Carcinoma.
26716871 2015 Identification of Promotor and Exonic Variations, and Functional Characterization of a Splice Site Mutation in Indian Patients with Unconjugated Hyperbilirubinemia.
26697581 2015 Two Different UGT1A1 Mutations causing Crigler-Najjar Syndrome types I and II in an Iranian Family.
26645279 2016 Phase II Drug-Metabolizing Polymorphisms and Smoking Predict Recurrence of Non-Muscle-Invasive Bladder Cancer: A Gene-Smoking Interaction.
26628212 2015 Serum bilirubin concentration is modified by UGT1A1 haplotypes and influences risk of type-2 diabetes in the Norfolk Island genetic isolate.
26494856 2015 High-Dose FOLFIRI plus Bevacizumab in the Treatment of Metastatic Colorectal Cancer Patients with Two Different UGT1A1 Genotypes: FFCD 0504 Study.
26482555 2015 Genomic profile predicts the efficacy of neoadjuvant chemotherapy for cervical cancer patients.
26467199 2015 Association of Neonatal Hyperbilirubinemia with UGT1A1 Gene Polymorphisms: A Meta-Analysis.
26403473 2016 Deferasirox-induced serious adverse reaction in a pediatric patient: pharmacokinetic and pharmacogenetic analysis.
26250421 2016 Genotype of UGT1A1 and phenotype correlation between Crigler-Najjar syndrome type II and Gilbert syndrome.
26247833 2016 Raloxifene glucuronidation in liver and intestinal microsomes of humans and monkeys: contribution of UGT1A1, UGT1A8 and UGT1A9.
26229432 2015 Relationship between UGT1A1*6/*28 polymorphisms and severe toxicities in Chinese patients with pancreatic or biliary tract cancer treated with irinotecan-containing regimens.
26223945 2015 Influence of UDP-Glucuronosyltransferase Polymorphisms on Stable Warfarin Doses in Patients with Mechanical Cardiac Valves.
26200705 2015 UGT1A1 gene mutations and neonatal hyperbilirubinemia in Guangxi Heiyi Zhuang and Han populations.
26146841 2015 Multiple Genetic Modifiers of Bilirubin Metabolism Involvement in Significant Neonatal Hyperbilirubinemia in Patients of Chinese Descent.
26125934 2015 Correlation of UGT1A1 and ERCC1 gene polymorphisms with the outcome of combined irinotecan plus cisplatin treatment in recurrent ovarian cancer.
26125716 2015 Polymorphism of UGT1A1*28 (TA)7 and liver damage in hepatitis B virus-positive patients in Albania.
26068529 2015 Accurate identification of UDP-glucuronosyltransferase 1A1 (UGT1A1) inhibitors using UGT1A1-overexpressing HeLa cells.
26068521 2016 Metabolism of the anthelmintic drug niclosamide by cytochrome P450 enzymes and UDP-glucuronosyltransferases: metabolite elucidation and main contributions from CYP1A2 and UGT1A1.
26039129 2015 Exome-Wide Association Study Identifies New Low-Frequency and Rare UGT1A1 Coding Variants and UGT1A6 Coding Variants Influencing Serum Bilirubin in Elderly Subjects: A Strobe Compliant Article.
26010150 2015 Drug-Metabolizing Activity, Protein and Gene Expression of UDP-Glucuronosyltransferases Are Significantly Altered in Hepatocellular Carcinoma Patients.
25997248 2015 UGT1A1*28 polymorphism influences glucuronidation of bazedoxifene.
25993113 2015 Spectrum of UGT1A1 Variations in Chinese Patients with Crigler-Najjar Syndrome Type II.
25981652 2015 [Examination of UGT1A1 polymorphisms and irinotecan-induced neutropenia in patients with Colorectal cancer].
25967674 2014 Prevalence of the UGT1A1*6 (c.211G>A) Polymorphism and Prediction of Irinotecan Toxicity in Iranian Populations of Different Ethnicities.
25953521 2015 Expression of UDP-Glucuronosyltransferase 1 (UGT1) and Glucuronidation Activity toward Endogenous Substances in Humanized UGT1 Mouse Brain.
25822733 2015 Co-inheritance of G6PD and PK deficiencies in a neonate carrying a Novel UGT1A1 genotype associated to Crigler-Najjar type II syndrome.
25782327 2015 DPD and UGT1A1 deficiency in colorectal cancer patients receiving triplet chemotherapy with fluoropyrimidines, oxaliplatin and irinotecan.
25778466 2015 A novel UGT1 marker associated with better tolerance against irinotecan-induced severe neutropenia in metastatic colorectal cancer patients.
25760534 2015 UDP-glucuronosyltransferase (UGT) 1A1 mainly contributes to the glucuronidation of trovafloxacin.
25741749 2015 Stable knock-down of efflux transporters leads to reduced glucuronidation in UGT1A1-overexpressing HeLa cells: the evidence for glucuronidation-transport interplay.
25712374 2015 Differential expression of the UGT1A family of genes in stomach cancer tissues.
25611851 2015 Restriction fragment length polymorphism effectively identifies exon 1 mutation of UGT1A1 gene in patients with Gilbert's Syndrome.
25545261 2016 Development of Pyrosequencing Method for Detection of UGT1A1 Polymorphisms in Thai Colorectal Cancers.
25488668 2015 Impaired O-linked N-acetylglucosaminylation in the endoplasmic reticulum by mutated epidermal growth factor (EGF) domain-specific O-linked N-acetylglucosamine transferase found in Adams-Oliver syndrome.
25478904 2015 Functional Study of Haplotypes in UGT1A1 Promoter to Find a Novel Genetic Variant Leading to Reduced Gene Expression.
25450281 2014 Uridine diphosphate glucuronide transferase 1A1FNx0128 gene polymorphism and the toxicity of irinotecan in recurrent and refractory small cell lung cancer.
25391605 2015 Association of neonatal hyperbilirubinemia in breast-fed infants with UGT1A1 or SLCOs polymorphisms.
25368098 2015 Bilirubin as a potential causal factor in type 2 diabetes risk: a Mendelian randomization study.
25312789 2014 Polymorphisms of CYP2C9, VKORC1, MDR1, APOE and UGT1A1 genes and the therapeutic warfarin dose in Brazilian patients with thrombosis: a prospective cohort study.
25262300 2014 Quantitative trait analysis of polymorphisms in two bilirubin metabolism enzymes to physiologic bilirubin levels in Chinese newborns.
25260839 2014 Influence of UGT1A1 gene methylation level in colorectal cancer cells on the sensitivity of the chemotherapy drug CPT-11.
25246029 2015 Genome-wide analysis of hepatic lipid content in extreme obesity.
25200497 2014 UGT1A1 sequence variants associated with risk of adult hyperbilirubinemia: a quantitative analysis.
25141892 2014 UGT1A1*28 polymorphisms: a potential pharmacological biomarker of irinotecan-based chemotherapies in colorectal cancer.
25105254 2014 UGT1A1*28 polymorphism and acute lymphoblastic leukemia in children: a Danish case-control study.
25102181 2014 Association of UGT1A1 variants and hyperbilirubinemia in breast-fed full-term Chinese infants.
25092941 2014 Extreme neonatal hyperbilirubinemia and a specific genotype: a population-based case-control study.
25086287 2014 Genetic variation underlying common hereditary hyperbilirubinaemia (Gilbert's syndrome) and respiratory health in the 1946 British birth cohort.
25072305 2014 Life-long correction of hyperbilirubinemia with a neonatal liver-specific AAV-mediated gene transfer in a lethal mouse model of Crigler-Najjar Syndrome.
25055799 2015 UGT1A1 *6 polymorphism predicts outcome in elderly patients with relapsed or refractory diffuse large B-cell lymphoma treated with carboplatin, dexamethasone, etoposide and irinotecan.
25016708 2014 Comprehensive analysis of UGT1A1 polymorphisms through high-resolution melting analysis and DNA sequencing.
24977443 2014 [Interest of UGT1A1 genotyping within digestive cancers treatment by irinotecan].
24958824 2014 Dose-finding and pharmacokinetic study to optimize the dosing of irinotecan according to the UGT1A1 genotype of patients with cancer.
24947795 2015 Do UGT1A1 and HMOX1 gene promoter polymorphisms increase the risk of hyperbilirubinemia and gallstones in patients with hereditary spherocytosis?
24901842 2014 Body fat percentage is a major determinant of total bilirubin independently of UGT1A1*28 polymorphism in young obese.
24898899 2014 Influence of UGT1A1 6, 27, and 28 polymorphisms on nilotinib-induced hyperbilirubinemia in Japanese patients with chronic myeloid leukemia.
24865931 2014 Combined effects of the UGT1A1 and OATP2 gene polymorphisms as major risk factor for unconjugated hyperbilirubinemia in Indian neonates.
24856997 2014 [Mutations in UGT1A1 gene in neonates with hyperbilirubinemia of Guangxi Heiyi Zhuang nationality].
24816252 2014 An atlas of genetic influences on human blood metabolites.
24815493 2014 Clinical observations on associations between the UGT1A1 genotype and severe toxicity of irinotecan.
24793765 2014 Two unrelated patients with rare Crigler-Najjar syndrome type I: two novel mutations and a patient with loss of heterozygosity of UGT1A1 gene.
24726540 2014 Severe neonatal hyperbilirubinemia and UGT1A1 promoter polymorphism.
24709690 2014 The effect of the UGT1A1*28 allele on survival after irinotecan-based chemotherapy: a collaborative meta-analysis.
24690955 2014 Serum bilirubin affects graft outcomes through UDP-glucuronosyltransferase sequence variation in kidney transplantation.
24650397 2014 Bilirubin uridine diphosphate-glucuronosyltransferase variation is a genetic basis of breast milk jaundice.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24620945 2014 Role of co-inherited Gilbert syndrome on hyperbilirubinemia in Indian beta thalassemia patients.
24615032 2014 Rapid molecular diagnosis of the Gilbert's syndrome-associated exon 1 mutation within the UGT1A1 gene.
24557078 2014 Genomewide association study of atazanavir pharmacokinetics and hyperbilirubinemia in AIDS Clinical Trials Group protocol A5202.
24519753 2014 Associations between UGT1A1*6 or UGT1A1*6/*28 polymorphisms and irinotecan-induced neutropenia in Asian cancer patients.
24516079 2014 High prevalence of the UGT1A1*28 variant in HIV-infected individuals in Greece.
24458221 2014 UGT1A1*28 polymorphism in chronic lymphocytic leukemia: the first investigation of the polymorphism in disease susceptibility and its specific cytogenetic abnormalities.
24453052 2014 Differences in UGT1A1, UGT1A7, and UGT1A9 polymorphisms between Uzbek and Japanese populations.
24403462 2014 Prospective phase II trial of second-line FOLFIRI in patients with advanced colorectal cancer including analysis of UGT1A1 polymorphisms: FLIGHT 2 study.
24403077 2014 Developmental onset of bilirubin-induced neurotoxicity involves Toll-like receptor 2-dependent signaling in humanized UDP-glucuronosyltransferase1 mice.
24401909 2014 Truncated UDP-glucuronosyltransferase (UGT) from a Crigler-Najjar syndrome type II patient colocalizes with intact UGT in the endoplasmic reticulum.
24390949 2013 UDP-glucuronosyltransferase promoter polymorphism in Iranian neonates with idiopathic hyperbilirubinemia.
24375494 Analysis of flavonoids regulating the expression of UGT1A1 via xenobiotic receptors in intestinal epithelial cells.
24341141 2013 Crigler-Najjar syndrome type I in a Turkish newborn caused by a novel mutation and Gilbert type genetic defect.
24329186 2014 Evaluation of the effect of UGT1A1 polymorphisms on dolutegravir pharmacokinetics.
24308720 2014 The association of UGT1A1*6 and UGT1A1*28 with irinotecan-induced neutropenia in Asians: a meta-analysis.
24286076 2013 UGT1A1 gene mutation due to Crigler-Najjar syndrome in Iranian patients: identification of a novel mutation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255116 2014 Alteration of the function of the UDP-glucuronosyltransferase 1A subfamily by cytochrome P450 3A4: different susceptibility for UGT isoforms and UGT1A1/7 variants.
24232666 2014 UGT1A1 gene variants and clinical risk factors modulate hyperbilirubinemia risk in newborns.
24217933 2014 Role of UGT1A1 and ADH gene polymorphisms in pegvisomant-induced liver toxicity in acromegalic patients.
24204915 2013 The effect of UGT1A1 promoter polymorphism in the development of hyperbilirubinemia and cholelithiasis in hemoglobinopathy patients.
24195516 2014 Relationship between the expression of CES2, UGT1A1, and GUSB in colorectal cancer tissues and aberrant methylation.
24167350 2013 Early complication in sickle cell anemia children due to A(TA)nTAA polymorphism at the promoter of UGT1A1 gene.
24114122 2013 UGT1A1 genotype-guided phase I study of irinotecan, oxaliplatin, and capecitabine.
24107802 2013 Hyperbilirubinemia in pazopanib- or sunitinib-treated patients in COMPARZ is associated with UGT1A1 polymorphisms.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24088753 2013 Risk factors for liver injury with an elevated serum bilirubin concentration caused by antituberculous drugs.
24088669 2013 Polymorphisms in the UGT1A1 gene predict adverse effects of irinotecan in the treatment of gynecologic cancer in Japanese patients.
24065680 2013 Role of a homozygous A(TA)?TAA promoter polymorphism and an exon 1 heterozygous frameshift mutation UGT1A1 in Crigler-Najjar syndrome type II in a Thai neonate.
24060717 UGT1A1 promoter polymorphism associated with serum bilirubin level in Saudi patients with sickle cell disease.
24057187 2013 Lack of association between the UDP-glucuronosyltransferase 1A1 (UGT1A1) gene polymorphism and the risk of benign prostatic hyperplasia in Caucasian men.
24033692 2013 UGT1A1*6, 1A7*3, and 1A9*22 genotypes predict severe neutropenia in FOLFIRI-treated metastatic colorectal cancer in two prospective studies in Japan.
23992562 2013 UGT1A1 gene mutations in Pakistani children suffering from inherited nonhemolytic unconjugated hyperbilirubinemias.
23981182 2014 Correlation of UGT1A1 TATA-box polymorphism and jaundice in breastfed newborns-early presentation of Gilbert's syndrome.
23964438 2012 Association between UGT 1A1 Gly71Arg (G71R) polymorphism and neonatal hyperbilirubinemia.
23950218 2013 Importance of UDP-glucuronosyltransferase 1A1 expression in skin and its induction by UVB in neonatal hyperbilirubinemia.
23926009 2013 [Mutation analysis of UGT1A1 gene in patients with unconjugated hyperbilirubinemia].
23898114 2013 UDP-glucuronosyltransferase (UGT) 1A1*28 polymorphism-directed phase II study of irinotecan with 5'-deoxy-5-fluorouridine (5'-DFUR) for metastatic colorectal cancer.
23892411 2013 Analysis of UGT1A1*28 genotype and SN-38 pharmacokinetics for irinotecan-based chemotherapy in patients with advanced colorectal cancer: results from a multicenter, retrospective study in Shanghai.
23881212 2013 CPT-11 as a second-line treatment for patients with advanced/metastatic gastric cancer who failed S-1 (CCOG0702).
23789755 [Influence of genetic polymorphisms in UGT1A1, UGT1A7 and UGT1A9 on the pharmacokynetics of irinotecan, SN-38 and SN-38G].
23783485 2013 Associations between UGT1A1*6/*28 polymorphisms and irinotecan-induced severe toxicity in Chinese gastric or esophageal cancer patients.
23781580 2013 UGT1A1 genotype-specific phase I and pharmacokinetic study for combination chemotherapy with irinotecan and cisplatin: a Saitama Tumor Board study.
23753274 2013 Extreme bilirubin levels as a causal risk factor for symptomatic gallstone disease.
23714156 2013 Gender matters: estrogen receptor alpha (ER?) and histone deacetylase (HDAC) 1 and 2 control the gender-specific transcriptional regulation of human uridine diphosphate glucuronosyltransferases genes (UGT1A).
23686699 2013 UGT1A1 6/28 polymorphisms could predict irinotecan-induced severe neutropenia not diarrhea in Chinese colorectal cancer patients.
23647681 2013 Evidence for regulation of UDP-glucuronosyltransferase (UGT) 1A1 protein expression and activity via DNA methylation in healthy human livers.
23642732 2013 Association of SNPs in the UGT1A gene cluster with total bilirubin and mortality in the Diabetes Heart Study.
23609856 2014 Association between severe toxicity of nilotinib and UGT1A1 polymorphisms in Japanese patients with chronic myelogenous leukemia.
23605141 2014 Usefulness of one-point plasma SN-38G/SN-38 concentration ratios as a substitute for UGT1A1 genetic information after irinotecan administration.
23580084 2013 UGT1A1*28 is associated with decreased systemic exposure of atorvastatin lactone.
23548653 2013 Effect of the UGT1A1*28 allele on unconjugated hyperbilirubinemia in HIV-positive patients receiving Atazanavir: a systematic review.
23537215 2013 The association between heterozygosity for UGT1A1*6, UGT1A1*28, and variation in the serum total-bilirubin level in healthy young Japanese adults.
23529007 2014 Association of UGT1A1*28 polymorphisms with irinotecan-induced toxicities in colorectal cancer: a meta-analysis in Caucasians.
23517300 2013 Gallstone disease in Swedish twins is associated with the Gilbert variant of UGT1A1.
23516488 2013 Association between UGT1A1*28 polymorphisms and clinical outcomes of irinotecan-based chemotherapies in colorectal cancer: a meta-analysis in Caucasians.
23461146 2011 [Polymorphisms of the UDP-glucuronosyltransferase 1-A1 gene in Tunisian population].
23401472 2013 Epigenetic regulation is a crucial factor in the repression of UGT1A1 expression in the human kidney.
23386248 2013 Refining the UGT1A haplotype associated with irinotecan-induced hematological toxicity in metastatic colorectal cancer patients treated with 5-fluorouracil/irinotecan-based regimens.
23371916 2013 A genome-wide association study for serum bilirubin levels and gene-environment interaction in a Chinese population.
23350445 2012 [Importance and practice of UGT1A1 polymorphisms].
23303296 2013 Polymorphisms of the UDP-glucuronosyl transferase 1A genes are associated with adverse events in cancer patients receiving irinotecan-based chemotherapy.
23290513 2013 UGT1A1 genetic analysis as a diagnostic aid for individuals with unconjugated hyperbilirubinemia.
23281178 2013 A genome-wide assessment of variability in human serum metabolism.
23236239 2012 UGT1A1 predicts outcome in colorectal cancer treated with irinotecan and fluorouracil.
23207817 Implication of genetic variation at the promoter and exon1 of UGT1A1 in occurrence of cholelithiasis in Tunisia.
23148825 2013 Protein-protein interactions between the bilirubin-conjugating UDP-glucuronosyltransferase UGT1A1 and its shorter isoform 2 regulatory partner derived from alternative splicing.
23148286 2013 Impact of UGT1A1 Gilbert variant on discontinuation of ritonavir-boosted atazanavir in AIDS Clinical Trials Group Study A5202.
23147267 2013 UDP-glucuronosyltransferase 1A1 (UGT1A1) gene haplotypes and their effect on serum bilirubin concentration in healthy Indian adults.
23130636 2013 Nuclear factor ?B down-regulates human UDP-glucuronosyltransferase 1A1: a novel mechanism involved in inflammation-associated hyperbilirubinaemia.
23099197 2013 Identification of a novel mutation in UDP-glucuronosyltransferase (UGT1A1) gene in a child with neonatal unconjugated hyperbilirubinemia.
23089802 2013 Function, genetic polymorphism, and transcriptional regulation of human UDP-glucuronosyltransferase (UGT) 1A1.
23053265 2013 Uridine diphosphate glucuronosyl transferase 1 family polypeptide A1 gene (UGT1A1) polymorphisms are associated with toxicity and efficacy in irinotecan monotherapy for refractory pancreatic cancer.
23014115 2013 Association of breast-fed neonatal hyperbilirubinemia with UGT1A1 polymorphisms: 211G>A (G71R) mutation becomes a risk factor under inadequate feeding.
22829544 2012 Regulation of pregnane X receptor (PXR) function and UGT1A1 gene expression by posttranslational modification of PXR protein.
22808571 2012 Wayward effect of polymorphism (TA)8 in the promoter region of UGT1A1 gene in a Mexican family.
22749334 2012 Effects of statin treatments and polymorphisms in UGT1A1 and SLCO1B1 on serum bilirubin levels in Chinese patients with hypercholesterolaemia.
22676194 2012 Impact of the UGT1A1*28 allele on response to irinotecan: a systematic review and meta-analysis.
22661630 2012 Quantification of Hepatic UDP glucuronosyltransferase 1A splice variant expression and correlation of UDP glucuronosyltransferase 1A1 variant expression with glucuronidation activity.
22648071 2012 UDP-glucuronosyltransferase 1A1 is the principal enzyme responsible for puerarin metabolism in human liver microsomes.
22579593 2012 Simultaneous evaluation of six human glucuronidation activities in liver microsomes using liquid chromatography-tandem mass spectrometry.
22559977 2012 Promoter length polymorphism in UGT1A1 and the risk of sporadic colorectal cancer.
22558097 2012 A genome-wide association study of total bilirubin and cholelithiasis risk in sickle cell anemia.
22537951 2012 [Genetic factors in the occurrence of neonatal unconjugated hyperbilirubinemia].
22511988 2012 A genome-wide association study identifies UGT1A1 as a regulator of serum cell-free DNA in young adults: The Cardiovascular Risk in Young Finns Study.
22475179 2012 Polymorphisms in genes encoding interleukin-10 and drug metabolizing enzymes GSTP1, GSTT1, GSTA1 and UGT1A1 influence risk and outcome in Hodgkin lymphoma.
22450351 Non tumoral hyperserotoninaemia responsive to octreotide due to dual polymorphism in UGT1A1 and UGT1A6.
22448797 2012 Gilbert syndrome: the UGT1A1*28 promoter polymorphism as a biomarker of multifactorial diseases and drug metabolism.
22398043 2012 A functional polymorphism in UGT1A1 related to hyperbilirubinemia is associated with a decreased risk for Crohn's disease.
22371261 2012 Pregnane-x-receptor controls hepatic glucuronidation during pregnancy and neonatal development in humanized UGT1 mice.
22367021 2012 High enzyme activity UGT1A1 or low activity UGT1A8 and UGT2B4 genotypes increase esophageal cancer risk.
22357454 2012 Lapatinib-induced liver injury characterized by class II HLA and Gilbert's syndrome genotypes.
22340355 2011 A new frame-shifting mutation of UGT1A1 gene causes type I Crigler-Najjar syndrome.
22325916 2012 Impact of UGT1A1 gene variants on total bilirubin levels in Gilbert syndrome patients and in healthy subjects.
22318545 2012 Inter and intra-ethnic differences in the distribution of the molecular variants of TPMT, UGT1A1 and MDR1 genes in the South Indian population.
22307138 2012 Sorafenib is an inhibitor of UGT1A1 but is metabolized by UGT1A9: implications of genetic variants on pharmacokinetics and hyperbilirubinemia.
22299209 2011 Prevalence of uridine glucuronosyl transferase 1A1 (UGT1A1) mutations in Malay neonates with severe jaundice.
22273851 2012 Effects of cytochrome P450 1A1 and uridine-diphosphate-glucuronosyltransferase 1A1 allelic polymorphisms on the risk of development and the prognosis of head and neck cancers.
22214020 2011 [Treatment with CPT-11 based on the UGT1A1 genetic polymorphism].
22213983 2011 [Importance and practice of UGT1A1 polymorphisms].
22212955 2012 Association of serum bilirubin and promoter variations in HMOX1 and UGT1A1 genes with sporadic colorectal cancer.
22199302 2011 Estrogen pathway polymorphisms and mammographic density.
22169899 2011 A homozygous mutation in UGT1A1 exon 5 may be responsible for persistent hyperbilirubinemia in a Japanese girl with Gilbert's syndrome.
22085899 2012 UGT1A1 is a major locus influencing bilirubin levels in African Americans.
22050734 2012 Short communication: UGT1A1*28 variant allele is a predictor of severe hyperbilirubinemia in HIV-infected patients on HAART in southern Brazil.
21983082 2012 Reduced expression of UGT1A1 in intestines of humanized UGT1 mice via inactivation of NF-?B leads to hyperbilirubinemia.
21978357 2012 Short communication: lack of correlation between UGT1A1*6, *28 genotypes, and plasma raltegravir concentrations in Japanese HIV type 1-infected patients.
21911884 No association of promoter variations of HMOX1 and UGT1A1 genes with liver injury in chronic hepatitis C.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21771722 2011 Repeat polymorphisms in estrogen metabolism genes and prostate cancer risk: results from the Prostate Cancer Prevention Trial.
21760472 2012 Bilirubin dependence on UGT1A1 polymorphisms, hemoglobin, fasting time and body mass index.
21646302 2011 Mayo Genome Consortia: a genotype-phenotype resource for genome-wide association studies with an application to the analysis of circulating bilirubin levels.
21614935 2011 Association of UGT1A1 Gly71Arg with urine urobilinogen.
21513526 2011 UGT1A1 sequence variants and bilirubin levels in early postnatal life: a quantitative approach.
21473286 2011 A fully integrated and automated detection system for single nucleotide polymorphisms of UGT1A1 and CYP2C19.
21411679 2011 Serum bilirubin links UGT1A1*28 polymorphism and predicts long-term cardiovascular events and mortality in chronic hemodialysis patients.
21351260 2010 Genetic polymorphism in the conjugating enzyme UGT1A1 and the risk of head and neck cancer.
21342357 2011 Association of neonatal hyperbilirubinemia with uridine diphosphate-glucuronosyltransferase 1A1 gene polymorphisms: meta-analysis.
21319362 2011 Hereditary spherocytosis coexisting with UDP-glucuronosyltransferase deficiency highly suggestive of Crigler-Najjar syndrome type II.
21317830 2011 Association of the UGT1A1-53(TA)n polymorphism with L-thyroxine doses required for thyrotropin suppression in patients with differentiated thyroid cancer.
21275655 Prevalence of UGT1A1 gene polymorphism in patients with hemolytic anemia in southern Brazil.
21272068 2011 Neonatal hyperbilirubinemia and Gly71Arg mutation of UGT1A1 gene: a Chinese case-control study followed by systematic review of existing evidence.
21266593 2011 The development of UDP-glucuronosyltransferases 1A1 and 1A6 in the pediatric liver.
21150467 2011 Randomized phase II trial of irinotecan with paclitaxel or gemcitabine for non-small cell lung cancer: association of UGT1A1*6 and UGT1A1*27 with severe neutropenia.
21092520 2010 [Roles of UGT 1A1 gene mutation in the development of neonatal hyperbilirubinemia in Guangxi].
21080475 Genetic influences on serum bilirubin in American Indians: The Strong Heart Family Study.
21072184 2010 Flavopiridol pharmacogenetics: clinical and functional evidence for the role of SLCO1B1/OATP1B1 in flavopiridol disposition.
20975617 2011 211 G to a variation of UDP-glucuronosyl transferase 1A1 gene and neonatal breastfeeding jaundice.
20948202 2010 Bilirubin and UGT1A1*28 are not associated with lower risk for ischemic stroke in a prospective nested case-referent setting.
20890421 2010 Incidence of atazanavir-associated hyperbilirubinemia in Korean HIV patients: 30 months follow-up results in a population with low UDP-glucuronosyltransferase1A1*28 allele frequency.
20865252 2011 Effects of UDP-glucuronosyltransferase polymorphisms on the pharmacokinetics of ezetimibe in healthy subjects.
20860988 2011 Phase II study of a triplet regimen of S-1 combined with irinotecan and oxaliplatin in patients with metastatic gastric cancer: clinical and pharmacogenetic results.
20837016 2010 Loci from a genome-wide analysis of bilirubin levels are associated with gallstone risk and composition.
20823282 2010 Pharmacokinetics and pharmacogenomics of once-daily raltegravir and atazanavir in healthy volunteers.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20709051 2010 The effect of UGT1A1 promoter polymorphism on bilirubin response to hydroxyurea therapy in hemoglobinopathies.
20686835 2010 Combined UGT1A1 and UGT1A6 genotypes together with a stressful life event increase breast cancer risk.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20653675 2010 Association of carboxylesterase 1A genotypes with irinotecan pharmacokinetics in Japanese cancer patients.
20650040 2010 Screening for G71R mutation of the UDP-glucuronosyltransferase 1 (UGT1A1) gene in neonates with pathologic and prolonged hyperbilirubinemia in Turkey.
20648548 2011 Selective regulation of UGT1A1 and SREBP-1c mRNA expression by docosahexaenoic, eicosapentaenoic, and arachidonic acids.
20647221 2011 Associations of various gene polymorphisms with toxicity in colorectal cancer patients receiving oral uracil and tegafur plus leucovorin: a prospective study.
20643254 2010 Relation of ADRB1, CYP2D6, and UGT1A1 polymorphisms with dose of, and response to, carvedilol or metoprolol therapy in patients with chronic heart failure.
20639394 2010 Genome-wide association of serum bilirubin levels in Korean population.
20628391 2010 UGT1A and TYMS genetic variants predict toxicity and response of colorectal cancer patients treated with first-line irinotecan and fluorouracil combination therapy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20620155 2010 Functional characterization of human and cynomolgus monkey UDP-glucuronosyltransferase 1A1 enzymes.
20610558 2010 Alternatively spliced products of the UGT1A gene interact with the enzymatically active proteins to inhibit glucuronosyltransferase activity in vitro.
20600030 2010 Coffee induces expression of glucuronosyltransferases by the aryl hydrocarbon receptor and Nrf2 in liver and stomach.
20580994 2010 The UGT1A1*28 polymorphism correlates with erlotinib's effect on SN-38 glucuronidation.
20562445 2010 Plasma bilirubin and UGT1A1*28 are not protective factors against first-time myocardial infarction in a prospective, nested case-referent setting.
20562211 2010 Dose-dependent association between UGT1A1*28 genotype and irinotecan-induced neutropenia: low doses also increase risk.
20546738 2010 Lentiviral vectors that express UGT1A1 in liver and contain miR-142 target sequences normalize hyperbilirubinemia in Gunn rats.
20530282 2010 Pharmacogenetic predictors of adverse events and response to chemotherapy in metastatic colorectal cancer: results from North American Gastrointestinal Intergroup Trial N9741.
20529348 2010 Combined effect of regulatory polymorphisms on transcription of UGT1A1 as a cause of Gilbert syndrome.
20528568 2011 Evaluation of UGT1A1 and SULT1A1 polymorphisms with lipid levels in women with different hormonal status.
20528217 2011 Neonatal hyperbilirubinemia and G71R mutation of the UGT1A1 gene in Turkish patients.
20504240 2010 Genetic factors influencing severe atazanavir-associated hyperbilirubinemia in a population with low UDP-glucuronosyltransferase 1A1*28 allele frequency.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20483464 2010 Serum bilirubin levels and UGT1A1 promoter variations in patients with schizophrenia.
20430047 2010 Biological definition of multiple chemical sensitivity from redox state and cytokine profiling and not from polymorphisms of xenobiotic-metabolizing enzymes.
20402064 A causal relationship between UDP-glucuronosyltransferase 1A1 promoter polymorphism and idiopathic hyperbilirubinemia in Turkish newborns.
20389299 2010 Pazopanib-induced hyperbilirubinemia is associated with Gilbert's syndrome UGT1A1 polymorphism.
20385995 2010 Pharmacogenetic assessment of toxicity and outcome in patients with metastatic colorectal cancer treated with LV5FU2, FOLFOX, and FOLFIRI: FFCD 2000-05.
20381444 2010 Polymorphisms in genes of the steroid hormone biosynthesis and metabolism pathways and endometrial cancer risk.
20378551 2010 Golgi N-glycosyltransferases form both homo- and heterodimeric enzyme complexes in live cells.
20377135 2010 The UGT1A1*28 genotype and the toxicity of low-dose irinotecan in patients with advanced lung cancer.
20376058 2010 Clinical and genetic risk factors for moderate hyperbilirubinemia in Brazilian newborn infants.
20371435 2010 Coexistence of HFE and rare UGT1A1 genes mutations in patients with iron overload related liver injury.
20358470 2010 DNA damage and repair: fruit and vegetable effects in a feeding trial.
20335017 2010 Dose-dependent association between UGT1A1*28 polymorphism and irinotecan-induced diarrhoea: a meta-analysis.
20308471 2010 Role of UDP-glucuronosyltransferase isoforms in 13-cis retinoic acid metabolism in humans.
20308029 2010 Genetic polymorphisms in the UDP-glucuronosyltransferase 1A1 (UGT1A1) gene and prostate cancer risk in Caucasian men.
20297805 2010 Use of glucuronidation fingerprinting to describe and predict mono- and dihydroxyflavone metabolism by recombinant UGT isoforms and human intestinal and liver microsomes.
20235787 2010 Common sequence variants in pharmacodynamic and pharmacokinetic pathway-related genes conferring LDL cholesterol response to statins.
20216541 2010 Oxaliplatin, irinotecan and capecitabine as first-line therapy in metastatic colorectal cancer (mCRC): a dose-finding study and pharmacogenomic analysis.
20215562 2010 A molecular model of the human UDP-glucuronosyltransferase 1A1, its membrane orientation, and the interactions between different parts of the enzyme.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
20207827 2010 Pegvisomant-induced liver injury is related to the UGT1A1*28 polymorphism of Gilbert's syndrome.
20197307 2010 Effect of oncostatin M on uridine diphosphate-5'-glucuronosyltransferase 1A1 through cross talk with constitutive androstane receptor.
20177420 2011 Prediction of irinotecan and 5-fluorouracil toxicity and response in patients with advanced colorectal cancer.
20173083 2010 Genetic variation in metabolizing enzyme and transporter genes: comprehensive assessment in 3 major East Asian subpopulations with comparison to Caucasians and Africans.
20142249 2010 Associations between polymorphisms in glucuronidation and sulfation enzymes and mammographic breast density in premenopausal women in the United States.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20136364 2010 Errors and reproducibility of DNA array-based detection of allelic variants in ADME genes: PHARMAchip.
20096102 2010 Regulation of UGT1A1 and HNF1 transcription factor gene expression by DNA methylation in colon cancer cells.
20087647 2010 The association between TA-repeat polymorphism in the promoter region of UGT1A1 and breast cancer risk: a meta-analysis.
20070246 2010 Gilbert-Meulengracht's syndrome and pharmacogenetics: is jaundice just the tip of the iceberg?
20064729 2010 Genetic factors associated with drug-resistance of epilepsy: relevance of stratification by patient age and aetiology of epilepsy.
20063115 2010 Phase II NCCTG trial of RT + irinotecan and adjuvant BCNU plus irinotecan for newly diagnosed GBM.
20061399 2010 Polymorphic variants of UGT1A1 in neonatal jaundice in southern Brazil.
20057336 2010 A polymorphic mutation, c.-3279T>G, in the UGT1A1 promoter is a risk factor for neonatal jaundice in the Malay population.
20056724 2010 Phase II metabolism of hesperetin by individual UDP-glucuronosyltransferases and sulfotransferases and rat and human tissue samples.
20038727 2010 Genotype-driven phase I study of irinotecan administered in combination with fluorouracil/leucovorin in patients with metastatic colorectal cancer.
20028383 2010 Phase I study of irinotecan and doxifluridine for metastatic colorectal cancer focusing on the UGT1A1*28 polymorphism.
19996319 2010 Modulation of the human glucuronosyltransferase UGT1A pathway by splice isoform polypeptides is mediated through protein-protein interactions.
19948621 2009 Variants in the UGT1A1 gene and the risk of pediatric nonalcoholic fatty liver disease.
19932091 2010 Rapid UGT1A1 (TA)(n) genotyping by high resolution melting curve analysis for Gilbert's syndrome diagnosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19891553 2009 Genetic polymorphisms of drug-metabolizing enzymes and anti-TB drug-induced hepatitis.
19888426 2009 Analysis of candidate genes in occurrence and growth of colorectal adenomas.
19861894 2009 UGT1A1 promoter genotype is not strongly associated with severity of coronary artery disease.
19859999 2009 UGT1A1 gene polymorphism: impact on toxicity and efficacy of irinotecan-based regimens in metastatic colorectal cancer.
19858398 2009 Association of molecular markers with toxicity outcomes in a randomized trial of chemotherapy for advanced colorectal cancer: the FOCUS trial.
19858149 2009 Complex multifactorial nature of significant hyperbilirubinemia in neonates.
19830808 2010 Crigler-Najjar syndrome in The Netherlands: identification of four novel UGT1A1 alleles, genotype-phenotype correlation, and functional analysis of 10 missense mutants.
19797611 2010 Induction of UGT1A1 and CYP2B6 by an antimitogenic factor in HepG2 cells is mediated through suppression of cyclin-dependent kinase 2 activity: cell cycle-dependent expression.
19771428 2010 Additive effects of drug transporter genetic polymorphisms on irinotecan pharmacokinetics/pharmacodynamics in Japanese cancer patients.
19732760 2009 Haplotypes in the UGT1A1 gene and their role as genetic determinants of bilirubin concentration in healthy German volunteers.
19712005 2009 UGT1A1, UGT1A6 and UGT1A7 genetic analysis: repercussion for irinotecan pharmacogenetics in the São Miguel Island Population (Azores, Portugal).
19683255 2009 Prolonged unconjugated hyperbiliriubinemia in breast-fed male infants with a mutation of uridine diphosphate-glucuronosyl transferase.
19674361 2009 Homozygous variant of UGT1A1 gene mutation and severe neonatal hyperbilirubinemia.
19639031 2008 Utility of Pretreatment Bilirubin Level and UGT1A1 Polymorphisms in Multivariate Predictive Models of Neutropenia Associated with Irinotecan Treatment in Previously Untreated Patients with Colorectal Cancer.
19636001 2009 Racial differences in advanced colorectal cancer outcomes and pharmacogenetics: a subgroup analysis of a large randomized clinical trial.
19620808 2009 [Two cases of advanced colorectal cancer with UGT1A1*28 homozygosity treated by FOLFIRI].
19546880 2009 Influence of ethnicity on pharmacogenetic variation in the Ghanaian population.
19545173 Structure and concentration changes affect characterization of UGT isoform-specific metabolism of isoflavones.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19513514 2009 Comprehensive analysis of excision repair complementation group 1, glutathione S-transferase, thymidylate synthase and uridine diphosphate glucuronosyl transferase 1A1 polymorphisms predictive for treatment outcome in patients with advanced gastric cancer treated with FOLFOX or FOLFIRI.
19486253 2009 Uridine diphosphate glucuronosyl transferase 1A1 promoter polymorphism is associated with choledocholithiasis in Taiwanese patients.
19482841 2009 Serum bilirubin levels on ICU admission are associated with ARDS development and mortality in sepsis.
19450125 2009 UGT1A1*28 genotype predicts gastrointestinal toxicity in patients treated with intermediate-dose irinotecan.
19430380 2009 UGT1A1 gene polymorphisms in North Indian neonates presenting with unconjugated hyperbilirubinemia.
19424794 2010 Genetic polymorphisms in phase I and phase II enzymes and breast cancer risk associated with menopausal hormone therapy in postmenopausal women.
19419973 2009 Common variants in the SLCO1B3 locus are associated with bilirubin levels and unconjugated hyperbilirubinemia.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
19406951 2009 Characterizing the effects of common UDP glucuronosyltransferase (UGT) 1A6 and UGT1A1 polymorphisms on cis- and trans-resveratrol glucuronidation.
19397531 2009 Genetic polymorphisms in Thai neonates with hyperbilirubinemia.
19390945 2009 UGT1A1*6 polymorphism is most predictive of severe neutropenia induced by irinotecan in Japanese cancer patients.
19389676 2009 Conditional linkage and genome-wide association studies identify UGT1A1 as a major gene for anti-atherogenic serum bilirubin levels--the Framingham Heart Study.
19371317 2009 Effects of UGT1A1*28 polymorphism on raloxifene pharmacokinetics and pharmacodynamics.
19364970 2009 Predictive role of the UGT1A1, UGT1A7, and UGT1A9 genetic variants and their haplotypes on the outcome of metastatic colorectal cancer patients treated with fluorouracil, leucovorin, and irinotecan.
19356098 2008 Induction of human UGT1A1 by bilirubin through AhR dependent pathway.
19352303 2009 Genetic variations in UGT1A1 and UGT2B7 and endometrial cancer risk.
19349543 2009 Phase III trial of irinotecan/cisplatin compared with etoposide/cisplatin in extensive-stage small-cell lung cancer: clinical and pharmacogenomic results from SWOG S0124.
19349540 2009 Comprehensive pharmacogenetic analysis of irinotecan neutropenia and pharmacokinetics.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19336732 2009 Cruciferous vegetable feeding alters UGT1A1 activity: diet- and genotype-dependent changes in serum bilirubin in a controlled feeding trial.
19325249 2009 UGT1A1 haplotype mutation among Asians in Singapore.
19309288 2009 Gilbert syndrome as a predisposing factor for cholelithiasis risk in the Greek adult population.
19303655 2009 Gilbert's syndrome and hyperbilirubinemia in protease inhibitor therapy--an extended haplotype of genetic variants increases risk in indinavir treatment.
19299905 2009 Clinical significance of UDP-glucuronosyltransferase 1A1*6 for toxicities of combination chemotherapy with irinotecan and cisplatin in gynecologic cancers: a prospective multi-institutional study.
19279563 2009 Pharmacokinetics of raltegravir in individuals with UGT1A1 polymorphisms.
19268007 2009 Does bilirubin level correspond to interaction of c.-3279T>G and A(TA)7TAA variants in UGT1A1 gene?
19243019 2009 Association of polymorphisms in four bilirubin metabolism genes with serum bilirubin in three Asian populations.
19238116 2009 Common variants of four bilirubin metabolism genes and their association with serum bilirubin and coronary artery disease in Chinese Han population.
19217809 Identification of a novel deletion in UDP-glucuronosyltransferase gene in a patient with Crigler-Najjar syndrome type I.
19207584 2009 UGT1A1 gene polymorphism as a potential factor inducing iron overload in the pathogenesis of type 1 hereditary hemochromatosis.
19204906 2009 Analysis of inherited genetic variations at the UGT1 locus in the French-Canadian population.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19141701 2009 Citrus fruit intake is associated with lower serum bilirubin concentration among women with the UGT1A1*28 polymorphism.
19077918 2009 C-reactive protein genotypes and haplotypes, polymorphisms in NSAID-metabolizing enzymes, and risk of colorectal polyps.
19021734 2009 Cholelithiasis in thalassemia major.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18992148 2008 Low-penetrance alleles predisposing to sporadic colorectal cancers: a French case-controlled genetic association study.
18990750 2008 Red meat intake, doneness, polymorphisms in genes that encode carcinogen-metabolizing enzymes, and colorectal cancer risk.
18982743 2008 Genotype frequencies of UDP-glucuronosyltransferase 1A1 promoter gene polymorphism in the population of healthy Croatian pre-scholars.
18981166 2009 Close association of UGT1A9 IVS1+399C>T with UGT1A1*28, *6, or *60 haplotype and its apparent influence on 7-ethyl-10-hydroxycamptothecin (SN-38) glucuronidation in Japanese.
18953066 2008 Genetic testing for UGT1A1*28 and *6 in Japanese patients who receive irinotecan chemotherapy.
18832463 2008 Rapid allelic discrimination by TaqMan PCR for the detection of the Gilbert's syndrome marker UGT1A1*28.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18797458 2008 Pharmacokinetic and pharmacogenetic determinants of the activity and toxicity of irinotecan in metastatic colorectal cancer patients.
18790042 2008 Serum bilirubin levels, UGT1A1 polymorphisms and risk for coronary artery disease.
18781851 2008 Variations in the UDP-glucuronosyltransferase 1A1 gene for the development of unconjugated hyperbilirubinemia in Taiwanese.
18768784 2009 Pharmacogenetic study in Hodgkin lymphomas reveals the impact of UGT1A1 polymorphisms on patient prognosis.
18756540 2008 UGT1A1 promoter polymorphisms and the development of hyperbilirubinemia and gallbladder disease in children with sickle cell anemia.
18695635 2008 Influence of drug transporters and UGT polymorphisms on pharmacokinetics of phenolic glucuronide metabolite of mycophenolic acid in Japanese renal transplant recipients.
18685565 2009 Phase I/II pharmacokinetic and pharmacogenomic study of UGT1A1 polymorphism in elderly patients with advanced non-small cell lung cancer treated with irinotecan.
18675828 2008 UGT1A1 and UGT1A9 functional variants, meat intake, and colon cancer, among Caucasians and African-Americans.
18597651 2008 Pharmacokinetics of mycophenolate mofetil and its glucuronide metabolites in healthy volunteers.
18594531 2008 UGT1A1*28 genotype and irinotecan dosage in patients with metastatic colorectal cancer: a Dutch Colorectal Cancer Group study.
18558634 2008 Coexpression of gene polymorphisms involved in bilirubin production and metabolism.
18547414 2008 Genotyping panel for assessing response to cancer chemotherapy.
18509181 2008 Predictive biomarkers of chemotherapy efficacy in colorectal cancer: results from the UK MRC FOCUS trial.
18498916 2008 Current target ranges of mycophenolic acid exposure and drug-related adverse events: a 5-year, open-label, prospective, clinical follow-up study in renal allograft recipients.
18491077 2008 Family 1 uridine-5'-diphosphate glucuronosyltransferases (UGT1A): from Gilbert's syndrome to genetic organization and variability.
18454993 2008 Influence of UDP-glucuronosyltransferase polymorphisms on mycophenolate mofetil-induced side effects in kidney transplant patients.
18430559 2008 Glucuronidation of the soyabean isoflavones genistein and daidzein by human liver is related to levels of UGT1A1 and UGT1A9 activity and alters isoflavone response in the MCF-7 human breast cancer cell line.
18419642 2008 A homozygous mutation in a Chinese man with Crigler-Najjar syndrome type II and a family genetic analysis.
18392554 2008 Early modification of sickle cell disease clinical course by UDP-glucuronosyltransferase 1A1 gene promoter polymorphism.
18379174 2008 [Irinotecan pharmacogenetics in Japanese cancer patients: roles of UGT1A1*6 and *28].
18375480 2008 Association between the UGT1A1 TA-repeat polymorphism and bilirubin concentration in patients with intermittent claudication: results from the CAVASIC study.
18349289 2008 Gilbert's Syndrome and irinotecan toxicity: combination with UDP-glucuronosyltransferase 1A7 variants increases risk.
18349273 2008 UGT1A1 genetic polymorphisms, endogenous estrogen exposure, soy food intake, and endometrial cancer risk.
18343383 2008 Gilbert syndrome, UGT1A1*28 allele, and cardiovascular disease risk: possible protective effects and therapeutic applications of bilirubin.
18335219 2008 Cisplatin plus weekly CPT-11/docetaxel in advanced esophagogastric cancer: a phase I study with pharmacogenetic assessment of XPD, XRCC3 and UGT1A1 polymorphisms.
18324905 2008 Rare TA repeats in promoter TATA box of the UDP glucuronosyltranferase (UGT1A1) gene in Croatian subjects.
18300238 2008 UGT1A1*28 polymorphism predicts irinotecan-induced severe toxicities without affecting treatment outcome and survival in patients with metastatic colorectal carcinoma.
18240903 2007 Pharmacogenetically relevant polymorphisms in Portugal.
18223459 2008 Genetic variations and haplotypes of UDP-glucuronosyltransferase 1A locus in a Korean population.
18221820 2009 Integrated pharmacogenetic prediction of irinotecan pharmacokinetics and toxicity in patients with advanced non-small cell lung cancer.
18181169 2008 Cooperation of docosahexaenoic acid and vitamin E in the regulation of UDP-glucuronosyltransferase mRNA expression.
18172616 2008 Transcriptional regulation of human UGT1A1 gene expression through distal and proximal promoter motifs: implication of defects in the UGT1A1 gene promoter.
18161889 2008 Detoxification enzyme polymorphisms are not involved in duodenal adenomatosis in familial adenomatous polyposis.
18082937 2008 Importance of UDP-glucuronosyltransferase 1A1*6 for irinotecan toxicities in Japanese cancer patients.
18081723 2008 Association between promoter and coding region mutations of UDP-glucuronosyltransferase 1A1 and beta-thalassemia/Hb E with cholelithiasis.
18052087 Disposition of flavonoids via enteric recycling: enzyme stability affects characterization of prunetin glucuronidation across species, organs, and UGT isoforms.
18043502 2008 (TA)n UDP-glucuronosyltransferase 1A1 promoter polymorphism in Nigerian neonates.
18004212 2007 Genetic diversity at the UGT1 locus is amplified by a novel 3' alternative splicing mechanism leading to nine additional UGT1A proteins that act as regulators of glucuronidation activity.
18004206 2007 Influence of mutations associated with Gilbert and Crigler-Najjar type II syndromes on the glucuronidation kinetics of bilirubin and other UDP-glucuronosyltransferase 1A substrates.
17990575 Genetic factors in neonatal hyperbilirubinemia and kernicterus.
17981384 2007 Differential effect of over-expressing UGT1A1 and CYP1A1 on xenobiotic assault in MCF-7 cells.
17978490 2007 Stereoselective metabolism of racemic carvedilol by UGT1A1 and UGT2B7, and effects of mutation of these enzymes on glucuronidation activity.
17952380 2008 Polymorphisms of the uridine-diphosphoglucuronosyltransferase 1A1 gene and coronary artery disease.
17949292 2007 Genetic polymorphisms in the UGT1A1 gene and breast cancer risk in Greek women.
17909964 2008 Genetic polymorphisms in uridine diphospho-glucuronosyltransferase 1A1 and breast cancer risk in Africans.
17898154 2007 Characterization of the UDP glucuronosyltransferase activity of human liver microsomes genotyped for the UGT1A1*28 polymorphism.
17888052 2007 Cord blood bilirubin level in relation to bilirubin UDP-glucuronosyltransferase gene missense allele in Chinese neonates.
17850628 2007 Combined UGT1A1 and UGT1A7 variant alleles are associated with increased risk of Gilbert's syndrome in Taiwanese adults.
17762398 2007 Distribution of the UGT1A1*28 polymorphism in Caucasian and Asian populations in the US: a genomic analysis of 138 healthy individuals.
17728214 2007 UGT1A1*28 genotype and irinotecan-induced neutropenia: dose matters.
17700594 2008 Influence of UGT1A9 intronic I399C>T polymorphism on SN-38 glucuronidation in Asian cancer patients.
17681105 2007 Increased frequency of uridine diphosphate glucuronosyltransferase 1A1 7/7 in patients experiencing severe irinotecan-induced toxicities.
17627617 2007 Role of UGT1A1*6, UGT1A1*28 and ABCG2 c.421C>A polymorphisms in irinotecan-induced neutropenia in Asian cancer patients.
17622938 2007 UGT1A1*28 genotype affects the in-vitro glucuronidation of thyroxine in human livers.
17611564 2007 UGT1A1 promoter polymorphism increases risk of nilotinib-induced hyperbilirubinemia.
17593033 2007 The linear effects of alpha-thalassaemia, the UGT1A1 and HMOX1 polymorphisms on cholelithiasis in sickle cell disease.
17578897 2007 The human UDP-glucuronosyltransferase: identification of key residues within the nucleotide-sugar binding site.
17577039 2007 UGT1A1 promoter genotype correlates with SN-38 pharmacokinetics, but not severe toxicity in patients receiving low-dose irinotecan.
17576806 2007 Stereoselective glucuronidation of 5-(4'-hydroxyphenyl)-5-phenylhydantoin by human UDP-glucuronosyltransferase (UGT) 1A1, UGT1A9, and UGT2B15: effects of UGT-UGT interactions.
17558305 2007 Irinotecan pharmacokinetics/pharmacodynamics and UGT1A genetic polymorphisms in Japanese: roles of UGT1A1*6 and *28.
17555467 2007 Limited influence of UGT1A1*28 and no effect of UGT2B7*2 polymorphisms on UGT1A1 or UGT2B7 activities and protein expression in human liver microsomes.
17549067 2008 Pharmacogenetic profiling in patients with advanced colorectal cancer treated with first-line FOLFIRI chemotherapy.
17530442 2008 Induction of human UGT1A1 by a complex of dexamethasone-GR dependent on proximal site and independent of PBREM.
17510208 2007 UGT1A1 polymorphism can predict hematologic toxicity in patients treated with irinotecan.
17506482 2007 Rapid detection of the UGT1A1 single nucleotide polymorphism G211A using real-time PCR with Taqman minor groove binder probes.
17498780 2007 The influence of metabolic gene polymorphisms on urinary 1-hydroxypyrene concentrations in Chinese coke oven workers.
17478602 2007 UDP-Glucuronosyltransferase 1A1 gene polymorphisms and total bilirubin levels in an ethnically diverse cohort of women.
17471158 2007 Validation of rapid polymerase chain reaction-based detection of all length polymorphisms in the UGT 1A1 gene promoter.
17459361 2007 Comparison of three methods for genotyping the UGT1A1 (TA)n repeat polymorphism.
17440429 2008 Hepatocyte nuclear factor-1 alpha is associated with UGT1A1, UGT1A9 and UGT2B7 mRNA expression in human liver.
17426648 2007 (TA)n UGT 1A1 promoter polymorphism: a crucial factor in the pathophysiology of jaundice in G-6-PD deficient neonates.
17409981 2006 A phase II study of irinotecan and carboplatin in advanced non-small cell lung cancer with pharmacogenomic analysis: final report.
17406868 2007 Genetic linkage of UGT1A7 and UGT1A9 polymorphisms to UGT1A1*6 is associated with reduced activity for SN-38 in Japanese patients with cancer.
17374650 2007 UGT1A1 polymorphism is associated with serum bilirubin concentrations in a randomized, controlled, fruit and vegetable feeding trial.
17372243 2007 Ovarian cancer risk and polymorphisms involved in estrogen catabolism.
17329852 2007 Evaluation of effects of polymorphism for metabolic enzymes on pharmacokinetics of carvedilol by population pharmacokinetic analysis.
17273745 2007 Combined analysis of genetic polymorphisms in thymidylate synthase, uridine diphosphate glucoronosyltransferase and X-ray cross complementing factor 1 genes as a prognostic factor in advanced colorectal cancer patients treated with 5-fluorouracil plus oxaliplatin or irinotecan.
17259171 2007 Nrf2-Keap1 signaling pathway regulates human UGT1A1 expression in vitro and in transgenic UGT1 mice.
17229650 2007 Seven novel mutations of the UGT1A1 gene in patients with unconjugated hyperbilirubinemia.
17196409 UGT1A1(TA)n promoter polymorphism--a new case of a (TA)8 allele in Caucasians.
17192505 2007 The role of SN-38 exposure, UGT1A1*28 polymorphism, and baseline bilirubin level in predicting severe irinotecan toxicity.
17187418 2007 Regulation of the UGT1A1 bilirubin-conjugating pathway: role of a new splicing event at the UGT1A locus.
17185998 2007 Irinotecan-induced diarrhea: functional significance of the polymorphic ABCC2 transporter protein.
17179145 2007 Oligomerization of the UDP-glucuronosyltransferase 1A proteins: homo- and heterodimerization analysis by fluorescence resonance energy transfer and co-immunoprecipitation.
17166930 2007 The frequency of UDP-glucuronosyltransferase 1A1 promoter region (TA)7 polymorphism in newborns and it's relation with jaundice.
17138857 2006 Further evidence that the UGT1A1*28 allele is not associated with coronary heart disease: The ECTIM Study.
17060921 2007 Intra-ethnic differences in genetic variants of the UGT-glucuronosyltransferase 1A1 gene in Chinese populations.
17000907 2006 Association between the UGT1A1*28 allele, bilirubin levels, and coronary heart disease in the Framingham Heart Study.
16985250 2006 Estrogen sulfation genes, hormone replacement therapy, and endometrial cancer risk.
16969497 2006 Linkage disequilibrium of UGT1A1 *6 and UGT1A1 *28 in relation to UGT1A6 and UGT1A7 polymorphisms.
16965601 2006 Pharmacogenetic impact of polymorphisms in the coding region of the UGT1A1 gene on SN-38 glucuronidation in Japanese patients with cancer.
16951398 2006 Prophylaxis of irinotecan-induced diarrhea with neomycin and potential role for UGT1A1*28 genotype screening: a double-blind, randomized, placebo-controlled study.
16909274 2006 UGT1A polymorphisms in a Swedish cohort and a human diversity panel, and the relation to bilirubin plasma levels in males and females.
16896007 2006 Relationship of hepatic functional imaging to irinotecan pharmacokinetics and genetic parameters of drug elimination.
16871576 2006 The liver X-receptor alpha controls hepatic expression of the human bile acid-glucuronidating UGT1A3 enzyme in human cells and transgenic mice.
16865249 2006 Potential application of GSTT1-null genotype in predicting toxicity associated to 5-fluouracil irinotecan and leucovorin regimen in advanced stage colorectal cancer patients.
16864595 2007 The influence of genetic polymorphisms in Ahr, CYP1A1, CYP1A2, CYP1B1, GST M1, GST T1 and UGT1A1 on urine 1-hydroxypyrene glucuronide concentrations in healthy subjects from Rio Grande do Sul, Brazil.
16849011 2006 Contribution of polymorphisms in UDP-glucuronosyltransferase and CYP2D6 to the individual variation in disposition of carvedilol.
16809730 2006 The role of UGT1A1*28 polymorphism in the pharmacodynamics and pharmacokinetics of irinotecan in patients with metastatic colorectal cancer.
16792515 2006 Combined test for UGT1A1 -3279T-->G and A(TA)nTAA polymorphisms best predicts Gilbert's syndrome in Italian pediatric patients.
16791115 2006 Pharmacogenetic characteristics of indinavir, zidovudine, and lamivudine therapy in HIV-infected adults: a pilot study.
16771603 2006 Pharmacogenetic screening for polymorphisms in drug-metabolizing enzymes and drug transporters in a Dutch population.
16735790 2006 Kernicterus associated with hereditary spherocytosis and UGT1A1 promoter polymorphism.
16712705 2006 Crigler-Najjar type II syndrome may result from several types and combinations of mutations in the UGT1A1 gene.
16637266 [Association of polymorphisms in SULT1A1 and UGT1A1 Genes with breast cancer risk and phenotypes in Russian women].
16636344 2006 Comprehensive analysis of UGT1A polymorphisms predictive for pharmacokinetics and treatment outcome in patients with non-small-cell lung cancer treated with irinotecan and cisplatin.
16610035 2006 Gilbert's syndrome: High frequency of the (TA)7 TAA allele in India and its interaction with a novel CAT insertion in promoter of the gene for bilirubin UDP-glucuronosyltransferase 1 gene.
16609363 2006 Relationship between hyperbilirubinaemia and UDP-glucuronosyltransferase 1A1 (UGT1A1) polymorphism in adult HIV-infected Thai patients treated with indinavir.
16557566 2006 Coinheritance of Gilbert syndrome-associated UGT1A1 mutation increases gallstone risk in cystic fibrosis.
16513443 2006 Organic anion transporting polypeptide 1B1 activity classified by SLCO1B1 genotype influences atrasentan pharmacokinetics.
16469709 2006 [Genetic analysis of the UGT1A1 gene mutation sites in a Chinese family suffered from Gilbert's syndrome].
16456808 2006 Uridine diphosphate glucuronosyl transferase 1A1 promoter polymorphism predicts the risk of gastrointestinal toxicity and fatigue induced by irinotecan-based chemotherapy.
16424820 2006 Study of the genetic determinants of UGT1A1 inducibility by phenobarbital in cultured human hepatocytes.
16399345 2005 Regulation of the human UGT1A1 gene by nuclear receptors constitutive active/androstane receptor, pregnane X receptor, and glucocorticoid receptor.
16280036 2005 Genetic polymorphisms in human SULT1A1 and UGT1A1 genes associate with breast tumor characteristics: a case-series study.
16257926 2005 The role of UGT1A1*28 mutation in jaundiced infants with hypertrophic pyloric stenosis.
16257834 2005 Clinical pharmacogenetics of irinotecan (CPT-11).
16255851 2005 [Role of genetic factors in occurrence of neonatal jaundice in Guangxi region].
16237771 2005 Effects of variant UDP-glucuronosyltransferase 1A1 gene, glucose-6-phosphate dehydrogenase deficiency and thalassemia on cholelithiasis.
16210851 2006 Frequencies of A(TA)7TAA, G71R, and G493R mutations of the UGT1A1 gene in the Malaysian population.
16171463 2005 Role of cysteine residues in the function of human UDP glucuronosyltransferase isoform 1A1 (UGT1A1).
16135700 2005 Differential UGT1A1 induction by chrysin in primary human hepatocytes and HepG2 Cells.
16004608 2005 The influence of uridine diphosphate glucuronosyl transferase 1A promoter polymorphisms, beta-globin gene haplotype, co-inherited alpha-thalassemia trait and Hb F on steady-state serum bilirubin levels in sickle cell anemia.
15931768 2005 An interethnic comparison of polymorphisms of the genes encoding drug-metabolizing enzymes and drug transporters: experience in Singapore.
15929176 2005 Link between colorectal cancer and polymorphisms in the uridine-diphosphoglucuronosyltransferase 1A7 and 1A1 genes.
15867280 2005 Cruciferae interact with the UGT1A1*28 polymorphism to determine serum bilirubin levels in humans.
15864130 2005 Haplotypes of variants in the UDP-glucuronosyltransferase1A9 and 1A1 genes.
15864125 2005 Genetic factors related to unconjugated hyperbilirubinemia amongst adults.
15864124 2005 Genetic polymorphism in the phenobarbital-responsive enhancer module of the UDP-glucuronosyltransferase 1A1 gene and irinotecan toxicity.
15857854 2005 Global gene expression as a function of germline genetic variation.
15855726 2005 Urinary excretion of phenytoin metabolites, 5-(4'-hydroxyphenyl)-5-phenylhydantoin and its O-glucuronide in humans and analysis of genetic polymorphisms of UDP-glucuronosyltransferases.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15771689 2005 Neonatal hyperbilirubinemia and the bilirubin uridine diphosphate-glucuronosyltransferase gene: the common -3263T > G mutation of phenobarbital response enhancer module is not associated with the neonatal hyperbilirubinemia in Japanese.
15746053 2005 Phase I pharmacokinetic, food effect, and pharmacogenetic study of oral irinotecan given as semisolid matrix capsules in patients with solid tumors.
15712364 2005 Spectrum of UGT1A1 mutations in Crigler-Najjar (CN) syndrome patients: identification of twelve novel alleles and genotype-phenotype correlation.
15710570 2005 Association of UGT1A1 polymorphism with prevalence and age at onset of cholelithiasis in sickle cell anemia.
15709212 2005 Cancer pharmacogenomics: powerful tools in cancer chemotherapy and drug development.
15684703 2004 Nonviral gene transfer into liver and muscle for treatment of hyperbilirubinemia in the gunn rat.
15586176 2005 Paternal isodisomy for chromosome 2 as the cause of Crigler-Najjar type I syndrome.
15572581 2005 Racial variability in haplotype frequencies of UGT1A1 and glucuronidation activity of a novel single nucleotide polymorphism 686C> T (P229L) found in an African-American.
15560369 2004 Stimulation of transcriptional expression of human UDP-glucuronosyltransferase 1A1 by dexamethasone.
15557560 2005 Transcriptional regulation of human UGT1A1 gene expression: activated glucocorticoid receptor enhances constitutive androstane receptor/pregnane X receptor-mediated UDP-glucuronosyltransferase 1A1 regulation with glucocorticoid receptor-interacting protein 1.
15523087 2004 Prediction of irinotecan pharmacokinetics by use of cytochrome P450 3A4 phenotyping probes.
15519273 2004 Influence of common variants in the pharmacokinetic genes (OATP-C, UGT1A1, and MRP2) on serum bilirubin levels in healthy subjects.
15491385 2004 Screening for G71R mutation of the UGT1A1 gene in the Javanese-Indonesian and Malay-Malaysian populations.
15472229 2004 Specificity and regioselectivity of the conjugation of estradiol, estrone, and their catecholestrogen and methoxyestrogen metabolites by human uridine diphospho-glucuronosyltransferases expressed in endometrium.
15455371 2005 Breast cancer risk associated with genotype polymorphism of the catechol estrogen-metabolizing genes: a multigenic study on cancer susceptibility.
15388579 2005 UGT1A1 variation and gallstone formation in sickle cell disease.
15320866 2004 Farnesol is glucuronidated in human liver, kidney and intestine in vitro, and is a novel substrate for UGT2B7 and UGT1A1.
15319464 2004 Risk factors for severe hyperbilirubinemia in neonates.
15319294 2004 Genetic polymorphisms in UDP-glucuronosyltransferases and glutathione S-transferases and colorectal cancer risk.
15318931 2004 UDP-glucuronosyltransferase and sulfotransferase polymorphisms, sex hormone concentrations, and tumor receptor status in breast cancer patients.
15304120 2004 Genetic polymorphisms of bilirubin uridine diphosphate-glucuronosyltransferase gene in Japanese patients with Crigler-Najjar syndrome or Gilbert's syndrome as well as in healthy Japanese subjects.
15297419 2004 Relevance of different UGT1A1 polymorphisms in irinotecan-induced toxicity: a molecular and clinical study of 75 patients.
15286088 2004 Influence of genetic variants in UGT1A1 and UGT1A9 on the in vivo glucuronidation of SN-38.
15280927 2004 UGT1A1 gene variations and irinotecan treatment in patients with metastatic colorectal cancer.
15254716 2004 UGT1A1*28 polymorphism in ovarian cancer patients.
15247627 2004 Functional polymorphisms of UDP-glucuronosyltransferases 1A1, 1A6 and 1A8 are not involved in chronic pancreatitis.
15180166 2004 Glucuronidation of acetaminophen is independent of UGT1A1 promotor genotype.
15179405 2004 UGT1A1 haplotypes associated with reduced glucuronidation and increased serum bilirubin in irinotecan-administered Japanese patients with cancer.
15111762 2004 Genetic polymorphisms in uridine diphospho-glucuronosyltransferase 1A1 (UGT1A1) and risk of breast cancer.
15049432 2004 Single-step identification of all length polymorphisms in the UGT1A1 gene promoter.
15007088 2004 Genetic variants in the UDP-glucuronosyltransferase 1A1 gene predict the risk of severe neutropenia of irinotecan.
14871858 2004 The functional UGT1A1 promoter polymorphism decreases endometrial cancer risk.
14672974 2004 Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation.
14647407 2004 A Gilbert's syndrome UGT1A1 variant confers susceptibility to tranilast-induced hyperbilirubinemia.
14616765 2003 Co-occurrence of three different mutations in the bilirubin UDP-glucuronosyltransferase gene in a Chinese family with Crigler-Najjar syndrome type I and Gilbert's syndrome.
14586211 2003 Weekly regimen of irinotecan/docetaxel in previously treated non-small cell lung cancer patients and correlation with uridine diphosphate glucuronosyltransferase 1A1 (UGT1A1) polymorphism.
14555305 2003 Thalassemia minor, the Gilbert mutation, and the risk of gallstones.
14550264 2003 Rapid proteasomal degradation of translocation-deficient UDP-glucuronosyltransferase 1A1 proteins in patients with Crigler-Najjar type II.
12972027 Glucose-6-phosphate dehydrogenase (G6PD) mutations and UDP-glucuronosyltransferase promoter polymorphism among G6PD deficient Kuwaitis.
12969965 2004 Effects of prednisone and genetic polymorphisms on etoposide disposition in children with acute lymphoblastic leukemia.
12960109 2003 Irinotecan pathway genotype analysis to predict pharmacokinetics.
12909459 2003 Heme oxygenase-1: unleashing the protective properties of heme.
12850492 The global distribution of length polymorphisms of the promoters of the glucuronosyltransferase 1 gene (UGT1A1): hematologic and evolutionary implications.
12850481 Analysis of the A(TA)(n)TAA configuration in the promoter region of the UGT1 A1 gene in Greek patients with thalassemia intermedia and sickle cell disease.
12800608 2003 Irinotecan treatment in cancer patients with UGT1A1 polymorphisms.
12743455 2003 Analyses of polymorphism for UGT1*1 exon 1 promoter in neonates with pathologic and prolonged jaundice.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12732365 2003 Frequent co-occurrence of the TATA box mutation associated with Gilbert's syndrome (UGT1A1*28) with other polymorphisms of the UDP-glucuronosyltransferase-1 locus (UGT1A6*2 and UGT1A7*3) in Caucasians and Egyptians.
12680285 [Glucose-6-phosphate dehydrogenase deficiency, neonatal hyperbilirubinemia and Gilbert syndrome].
12677174 2003 UGT1A promoter polymorphisms influence bilirubin response to hydroxyurea therapy in sickle cell anemia.
12646172 2003 Evidence for phosphorylation requirement for human bilirubin UDP-glucuronosyltransferase (UGT1A1) activity.
12602902 2003 Polymorphisms in steroid hormone pathway genes and mammographic density.
12566446 2003 Involvement of the xenobiotic response element (XRE) in Ah receptor-mediated induction of human UDP-glucuronosyltransferase 1A1.
12502904 2002 Gly71Arg mutation of the bilirubin UDP-glucuronosyltransferase 1A1 gene is associated with neonatal hyperbilirubinemia in the Japanese population.
12499798 2002 [A study of polymorphism in UDP-glucuronosyltransferase 1 (UGT-1A1) promoter gene in Korean patients with Gilbert's syndrome].
12480568 2003 Inherited disorders of bilirubin metabolism.
12480553 2003 Combined polymorphisms in UDP-glucuronosyltransferases 1A1 and 1A6: implications for patients with Gilbert's syndrome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475965 2002 A subset of chaperones and folding enzymes form multiprotein complexes in endoplasmic reticulum to bind nascent proteins.
12439228 2002 Coinheritance of variant UDP-glucuronosyl transferase 1A1 gene and glucose-6-phosphate dehydrogenase deficiency in adults with hyperbilirubinemia.
12402338 2002 Association of a homozygous (TA)8 promoter polymorphism and a N400D mutation of UGT1A1 in a child with Crigler-Najjar type II syndrome.
12357057 2002 Relationship between bilirubin UDP-glucuronosyl transferase 1A1 gene and neonatal hyperbilirubinemia.
12185559 2002 Morphine glucuronide-to-morphine plasma ratios are unaffected by the UGT2B7 H268Y and UGT1A1*28 polymorphisms in cancer patients on chronic morphine therapy.
12151360 2002 Sulforaphane and its glutathione conjugate but not sulforaphane nitrile induce UDP-glucuronosyl transferase (UGT1A1) and glutathione transferase (GSTA1) in cultured cells.
12139570 2002 Novel missense mutation of the UGT1A1 gene in Thai siblings with Gilbert's syndrome.
12105841 2002 Glucose-6-phosphate dehydrogenase deficiency, the UDP-glucuronosyl transferase 1A1 gene, and neonatal hyperbilirubinemia.
12078936 2002 Predicting the risk of sporadic elevated bilirubin levels and diagnosing Gilbert's syndrome by genotyping UGT1A1*28 promoter polymorphism.
12036456 2002 Genetic polymorphisms of the UDP-glucuronosyltransferase 1A7 gene and irinotecan toxicity in Japanese cancer patients.
11987245 Genotyping by"cold single-strand conformation polymorphism" of the UGT1A1 promoter polymorphism in Mexican mestizos.
11968090 2002 Crigler-Najjar syndrome type I in Tunisia may be associated with a founder effect related to the Q357R mutation within the UGT1 gene.
11915038 2002 Hemolysis and bilirubin conjugation in association with UDP-glucuronosyltransferase 1A1 promoter polymorphism.
11827650 2002 [Interest in the study of genetic variants of the promoter region of the UGT1A1 gene in neonatal jaundice].
11764096 2001 Gilbert syndrome associated with beta-thalassemia.
11465080 2000 UDP-glucuronosyltransferases.
11434514 2001 Thirteen UDPglucuronosyltransferase genes are encoded at the human UGT1 gene complex locus.
11401924 2001 Association of genetic polymorphisms in UGT1A1 with breast cancer and plasma hormone levels.
11370628 2001 Interaction of coding region mutations and the Gilbert-type promoter abnormality of the UGT1A1 gene causes moderate degrees of unconjugated hyperbilirubinaemia and may lead to neonatal kernicterus.
11179460 2001 Glucuronidation of the nonsteroidal antiestrogen EM-652 (SCH 57068), by human and monkey steroid conjugating UDP-glucuronosyltransferase enzymes.
11156391 2000 Polymorphisms of UDP-glucuronosyltransferase gene and irinotecan toxicity: a pharmacogenetic analysis.
11141380 2000 [Distribution of the A(TA)7TAA genotype associated with Gilbert syndrome in the Spanish population].
11061796 2000 Prolonged unconjugated hyperbilirubinemia associated with breast milk and mutations of the bilirubin uridine diphosphate- glucuronosyltransferase gene.
11013440 2000 Genetic lesions of bilirubin uridine-diphosphoglucuronate glucuronosyltransferase (UGT1A1) causing Crigler-Najjar and Gilbert syndromes: correlation of genotype to phenotype.
10946897 2000 Characterization of the uridine diphosphate-glucuronosyltransferase-catalyzing thyroid hormone glucuronidation in man.
10836148 2000 Human UDP-glucuronosyltransferases: metabolism, expression, and disease.
10748067 2000 Polymorphic gene regulation and interindividual variation of UDP-glucuronosyltransferase activity in human small intestine.
10706110 2000 Genetic polymorphisms in uridine diphospho-glucuronosyltransferase 1A1 and association with breast cancer among African Americans.
10498597 1999 Coinheritance of Gilbert syndrome increases the risk for developing gallstones in patients with hereditary spherocytosis.
10412811 1999 A case of anorexia nervosa with hyperbilirubinaemia in a patient homozygous for a mutation in the bilirubin UDP-glucuronosyltransferase gene.
9639672 1998 Coding defect and a TATA box mutation at the bilirubin UDP-glucuronosyltransferase gene cause Crigler-Najjar type I disease.
9627603 1998 Gilbert syndrome caused by a homozygous missense mutation (Tyr486Asp) of bilirubin UDP-glucuronosyltransferase gene.
9621515 1998 Analysis of bilirubin uridine 5'-diphosphate (UDP)-glucuronosyltransferase gene mutations in seven patients with Crigler-Najjar syndrome type II.
9535849 1998 Expression of the UDP-glucuronosyltransferase 1A locus in human colon. Identification and characterization of the novel extrahepatic UGT1A8.
9497253 1998 Splice-site mutations: a novel genetic mechanism of Crigler-Najjar syndrome type 1.
9375768 1997 Hyperbilirubinaemia in heterozygous beta-thalassaemia is related to co-inherited Gilbert's syndrome.
9295054 1997 The UDP glycosyltransferase gene superfamily: recommended nomenclature update based on evolutionary divergence.
9039987 1997 Molecular analysis of patients of Sardinian descent with Crigler-Najjar syndrome type I.
8706880 1996 A mutation which disrupts the hydrophobic core of the signal peptide of bilirubin UDP-glucuronosyltransferase, an endoplasmic reticulum membrane protein, causes Crigler-Najjar type II.
8528206 1995 Gilbert's syndrome is caused by a heterozygous missense mutation in the gene for bilirubin UDP-glucuronosyltransferase.
8514037 1993 A mutation in bilirubin uridine 5'-diphosphate-glucuronosyltransferase isoform 1 causing Crigler-Najjar syndrome type II.
8467709 1993 Assignment of the human UDP glucuronosyltransferase gene (UGT1A1) to chromosome region 2q37.
8280139 1993 Identification of defect in the genes for bilirubin UDP-glucuronosyl-transferase in a patient with Crigler-Najjar syndrome type II.
8276413 1993 Identification of an A-to-G missense mutation in exon 2 of the UGT1 gene complex that causes Crigler-Najjar syndrome type 2.
8226884 1993 A phenylalanine codon deletion at the UGT1 gene complex locus of a Crigler-Najjar type I patient generates a pH-sensitive bilirubin UDP-glucuronosyltransferase.
8027054 1994 Bilirubin UDP-glucuronosyltransferase 1 is the only relevant bilirubin glucuronidating isoform in man.
7989595 1994 Discrimination between Crigler-Najjar type I and II by expression of mutant bilirubin uridine diphosphate-glucuronosyltransferase.
7989045 1994 Genetic heterogeneity of Crigler-Najjar syndrome type I: a study of 14 cases.
7936809 1994 A new type of defect in the gene for bilirubin uridine 5'-diphosphate-glucuronosyltransferase in a patient with Crigler-Najjar syndrome type I.
7906695 1994 Identification of two single base substitutions in the UGT1 gene locus which abolish bilirubin uridine diphosphate glucuronosyltransferase activity in vitro.
7715297 1995 Analysis of genes for bilirubin UDP-glucuronosyltransferase in Gilbert's syndrome.
7565971 1995 The genetic basis of the reduced expression of bilirubin UDP-glucuronosyltransferase 1 in Gilbert's syndrome.
3141926 1988 Cloning and substrate specificity of a human phenol UDP-glucuronosyltransferase expressed in COS-7 cells.
3082969 1986 Microsomal UDP-glucuronyltransferase-catalyzed bilirubin diglucuronide formation in human liver.
2108603 1990 Chromosomal mapping of a human phenol UDP-glucuronosyltransferase, GNT1.
1898728 1991 Cloning of two human liver bilirubin UDP-glucuronosyltransferase cDNAs with expression in COS-1 cells.
1634606 1992 Identification of a genetic alteration in the code for bilirubin UDP-glucuronosyltransferase in the UGT1 gene complex of a Crigler-Najjar type I patient.
1634050 1992 Mechanisms of inherited deficiencies of multiple UDP-glucuronosyltransferase isoforms in two patients with Crigler-Najjar syndrome, type I.
1339448 1992 A novel complex locus UGT1 encodes human bilirubin, phenol, and other UDP-glucuronosyltransferase isozymes with identical carboxyl termini.