Property Summary

NCBI Gene PubMed Count 24
PubMed Score 337.92
PubTator Score 84.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.300 1.9e-03
hepatocellular carcinoma 1.400 6.8e-05
pancreatic cancer 1.200 5.3e-03
Waldenstrons macroglobulinemia 1.617 1.3e-03
Multiple myeloma 1.425 1.9e-03
astrocytoma -2.100 1.3e-03
oligodendroglioma -1.600 3.0e-02
psoriasis 1.400 4.1e-04
osteosarcoma -1.219 4.1e-05
glioblastoma -1.100 1.8e-02
atypical teratoid / rhabdoid tumor -1.100 2.2e-04
medulloblastoma -1.400 1.2e-06
medulloblastoma, large-cell -2.300 6.2e-07
primitive neuroectodermal tumor -1.200 1.1e-04
tuberculosis -1.700 5.3e-04
pancreatic ductal adenocarcinoma liver m... -2.226 4.0e-03
colon cancer -1.500 1.2e-04
pancreatic carcinoma 1.200 5.3e-03
ductal carcinoma in situ -1.300 8.2e-04
invasive ductal carcinoma -1.400 3.4e-03
ulcerative colitis -1.200 1.6e-06
ovarian cancer -3.400 1.7e-11

Protein-protein Interaction (2)

Gene RIF (4)

PMID Text
23254995 This study provides clear evidence that the octameric state is a prerequisite for activity in the uridine diphosphate-glucose pyrophosphorylase.
22132858 The crystal structure was determined and shown to form octamers through end-to-end and side-by-side interactions. Mutagenesis studies showed that both dissociation of octamers and mutations of the latch loop can significantly affect the activity.
20514852 Observational study of gene-disease association. (HuGE Navigator)
20300197 GYS1 regulation by HIF plays a central role in the hypoxic accumulation of glycogen, and hypoxia also upregulates the expression of UTP:glucose-1-phosphate urydylyltransferase (UGP2) and 1,4-alpha glucan branching enzyme (GBE1)

AA Sequence

MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKG      1 - 70
PSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLD     71 - 140
LTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY    141 - 210
SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVM    211 - 280
EVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDM    281 - 350
EIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE    351 - 420
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPP    421 - 490
GAVLENKIVSGNLRILDH                                                        491 - 508
//

Text Mined References (33)

PMID Year Title
25860585 2015 A quaternary mechanism enables the complex biological functions of octameric human UDP-glucose pyrophosphorylase, a key enzyme in cell metabolism.
25416956 2014 A proteome-scale map of the human interactome network.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23254995 2013 Octamerization is essential for enzymatic function of human UDP-glucose pyrophosphorylase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22132858 2012 The crystal structure of human UDP-glucose pyrophosphorylase reveals a latch effect that influences enzymatic activity.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20514852 2009 Variants of organic anion transporter polypeptide 2 gene are not risk factors associated with severe neonatal hyperbilirubinemia.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20300197 2010 Hypoxia promotes glycogen accumulation through hypoxia inducible factor (HIF)-mediated induction of glycogen synthase 1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17482904 2007 Molecular mechanism of phase I and phase II drug-metabolizing enzymes: implications for detoxification.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
8631325 1996 Sequence differences between human muscle and liver cDNAs for UDPglucose pyrophosphorylase and kinetic properties of the recombinant enzymes expressed in Escherichia coli.
8612650 1996 The importance of conserved residues in human liver UDPglucose pyrophosphorylase.
8354390 1993 Cloning of a human liver UDP-glucose pyrophosphorylase cDNA by complementation of the bacterial galU mutation.
5427280 1970 Uridine diphosphate glucose pyrophosphorylase. IV. Crystallization and properties of the enzyme from human liver.