Property Summary

NCBI Gene PubMed Count 40
PubMed Score 245.92
PubTator Score 105.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active ulcerative colitis -1.178 3.0e-02
Astrocytoma, Pilocytic 2.200 6.4e-08
atypical teratoid / rhabdoid tumor 1.100 1.7e-03
Breast cancer 2.700 2.7e-02
chronic rhinosinusitis -1.023 5.3e-03
colon cancer -1.200 3.4e-03
glioblastoma 1.600 6.1e-07
interstitial cystitis -1.100 2.1e-04
medulloblastoma 1.300 1.1e-04
ovarian cancer -1.300 4.6e-04
pancreatic ductal adenocarcinoma liver m... -2.054 1.5e-03
pediatric high grade glioma 1.300 1.4e-04
primitive neuroectodermal tumor 1.300 5.1e-04

PDB (13)

Gene RIF (27)

AA Sequence

MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLF      1 - 70
FSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESI     71 - 140
RRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILT    141 - 210
TNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKD    211 - 280
VLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSS    281 - 350
IYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMF    351 - 420
KELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNK    421 - 490
KPKV                                                                      491 - 494
//

Text Mined References (45)

PMID Year Title