Property Summary

NCBI Gene PubMed Count 38
PubMed Score 243.69
PubTator Score 105.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma 1.600 6.1e-07
sonic hedgehog group medulloblastoma 1.600 1.8e-04
atypical teratoid/rhabdoid tumor 1.400 7.1e-05
primitive neuroectodermal tumor 1.300 5.1e-04
pancreatic ductal adenocarcinoma liver m... -2.054 1.5e-03
colon cancer -1.200 3.4e-03
ulcerative colitis -1.600 1.2e-06
Breast cancer 2.700 2.7e-02
interstitial cystitis -1.100 2.1e-04
pediatric high grade glioma 1.300 1.4e-04
pilocytic astrocytoma 2.200 8.0e-08
ovarian cancer -1.300 4.6e-04
chronic rhinosinusitis -1.023 5.3e-03

Synonym

Accession O60701 B3KUU2 B4DN25 O60589 UDP-Glc dehydrogenase
Symbols GDH
UGD
UDPGDH
UDP-GlcDH

Gene

PANTHER Protein Class (2)

PDB

2Q3E   2QG4   3ITK   3KHU   3PRJ   3PTZ   3TDK   3TF5   4EDF   4QEJ   4RJT  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (25)

PMID Text
25478983 UGDH displays hysteresis because of a slow isomerization from an inactive state (E*) to an active state (E). We show that the structure of E* constrains UGDH in a conformation that favors feedback inhibition at physiological pH.
25465897 UGDH protein level in osteoarthritis cartilage was much lower than in control cartilage.
24145036 Kinetic analysis of wild-type UGDH and hexamer T325A showed that upon increasing enzyme concentration, which favors the hexameric species, activity was decreased and exhibited cooperativity. Cooperative kinetics was not observed in obligate dimer T325D.
23363239 Mammalian UGDH displays hysteresis (observed as a lag in progress curves), indicating that the enzyme undergoes a slow transition from an inactive to an active state. Human UGDH is sensitive to product inhibition during the lag.
22815472 both missense mutations significantly reducing the ability of UGDH to provide precursors for cardiac cushion formation, which is essential to subsequent valve formation.
22123821 Structural and kinetic evidence that catalytic reaction of human UDP-glucose 6-dehydrogenase involves covalent thiohemiacetal and thioester enzyme intermediates.
21984906 An alternate crystal structure of human UGDH (hUGDH) in complex with UDP-glucose at 2.8 A resolution, is reported.
21961565 A structurally detailed model of UDP-alpha-D-glucose 6-dehydrogenase (UGDH) demonstrates hinge-bending motion that represents allosteric feedback inhibition and substrate-product exchange during the catalytic cycle.
21595445 An atypical allosteric mechanism in human UDP-alpha-D-glucose 6-dehydrogenase (UGDH) based on an easily acquired and identifiable structural attribute: packing defects in the protein core.
21576248 high UGDH levels may underlie susceptibility of the orbit to localized overproduction of hyaluronan in Graves disease.
21502315 Structure and mechanism of human UDP-glucose 6-dehydrogenase.
20691680 UGDH can regulate cell motility through the production of glycosaminoglycans
20421487 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19676054 Results support the UGDH content in prostatic acini as a novel candidate biomarker that may complement the development of a multi-biomarker panel for detecting PC within the tumor adjacent field on a histologically normal biopsy specimen.
19358821 perturbation caused by the mutation of a residue at a considerably distant location from the oligomeric interfaces is preferentially distributed throughout specific sites, especially the large flexible regions in the UGDH structure
18717819 This demonstrates that the UGDH transcript and protein quantities, the enzyme activity, and glycosaminoglycan contents increase in LMP2A overexpressed human embryonic kidney 293 (HEK293) cells.
17927902 Results suggest that UGDH Ala222 and Ser233 play an important role in maintaining the hexameric structure and the reduced binding affinities for substrates are attributable to its altered subunit communication.
17209547 Alteration of lysine 220 to alanine, histidine, or arginine significantly impaired enzyme function.
17073734 UGDH was purified and crystallized, and diffraction data proposes that the biological unit of UGDH is a tetramer.
16495656 report the presence of an inhibitory cis-element in the distal region of the UGDH promoter that interacts with putative transcriptional repressors for the negative regulation of the UGDH gene
16002992 Our results indicate that the region from nucleotide position -486 to -632 relative to the start of the small transcript contains positive regulatory elements that contribute to gene expression.
15898741 C276 plays an important role for efficient binding of UDP-glucose to hUGDH
15247292 Gly-13 plays an important role for efficient binding of NAD(+) to human UDP-glucose dehydrogenase
15044486 role of Cys-276 as a catalytic residue; Lys-279 is likely to have a role in positioning active site residues and in maintaining the hexameric quaternary structure
12682078 UGDH core promoter has a role in up- and down-regulation of UGDH after TGF-beta stimulation and in hypoxic conditions

AA Sequence

MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLF      1 - 70
FSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESI     71 - 140
RRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILT    141 - 210
TNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKD    211 - 280
VLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSS    281 - 350
IYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPGVSEDDQVSRLVTISKDPYEACDGAHAVVICTEWDMF    351 - 420
KELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNK    421 - 490
KPKV                                                                      491 - 494
//

Text Mined References (43)

PMID Year Title
25478983 2014 Hysteresis in human UDP-glucose dehydrogenase is due to a restrained hexameric structure that favors feedback inhibition.
25465897 2014 UDP-glucose dehydrogenase modulates proteoglycan synthesis in articular chondrocytes: its possible involvement and regulation in osteoarthritis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145036 2013 UDP-glucose dehydrogenase activity and optimal downstream cellular function require dynamic reorganization at the dimer-dimer subunit interfaces.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23363239 2013 Hysteresis and negative cooperativity in human UDP-glucose dehydrogenase.
22815472 2012 UDP-glucose dehydrogenase polymorphisms from patients with congenital heart valve defects disrupt enzyme stability and quaternary assembly.
22123821 2012 Structural and kinetic evidence that catalytic reaction of human UDP-glucose 6-dehydrogenase involves covalent thiohemiacetal and thioester enzyme intermediates.
21984906 2011 Structural basis of cooperativity in human UDP-glucose dehydrogenase.
21961565 2011 Conformational flexibility in the allosteric regulation of human UDP-?-D-glucose 6-dehydrogenase.
21595445 2011 Role of packing defects in the evolution of allostery and induced fit in human UDP-glucose dehydrogenase.
21576248 2011 Divergent Sp1 protein levels may underlie differential expression of UDP-glucose dehydrogenase by fibroblasts: role in susceptibility to orbital Graves disease.
21502315 2011 Structure and mechanism of human UDP-glucose 6-dehydrogenase.
21269460 2011 Initial characterization of the human central proteome.
20691680 2010 Down-regulation of UDP-glucose dehydrogenase affects glycosaminoglycans synthesis and motility in HCT-8 colorectal carcinoma cells.
20421487 2010 Genome-wide association identifies candidate genes that influence the human electroencephalogram.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19676054 2010 Udp-glucose dehydrogenase as a novel field-specific candidate biomarker of prostate cancer.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19358821 2009 Computational analysis of the quaternary structural changes induced by point mutations in human UDP-glucose dehydrogenase.
18717819 2008 Epstein-Barr virus latent membrane protein 2A upregulates UDP-glucose dehydrogenase gene expression via ERK and PI3K/Akt pathway.
17927902 2007 Alteration of the quaternary structure of human UDP-glucose dehydrogenase by a double mutation.
17482904 2007 Molecular mechanism of phase I and phase II drug-metabolizing enzymes: implications for detoxification.
17209547 2007 Characterization of human UDP-glucose dehydrogenase reveals critical catalytic roles for lysine 220 and aspartate 280.
17073734 2006 Expression, purification, crystallization, and preliminary X-Ray analysis of the human UDP-glucose dehydrogenase.
16495656 2006 Identification of a cis-acting element responsible for negative regulation of the human UDP-glucose dehydrogenase gene expression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16021519 2005 A two-dimensional electrophoresis reference map of human ovary.
16002992 2005 Analysis of human UDP-glucose dehydrogenase gene promoter: identification of an Sp1 binding site crucial for the expression of the large transcript.
15898741 Identification of a UDP-glucose-binding site of human UDP-glucose dehydrogenase by photoaffinity labeling and cassette mutagenesis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247292 2004 Importance of Gly-13 for the coenzyme binding of human UDP-glucose dehydrogenase.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15044486 2004 Characterization of human UDP-glucose dehydrogenase. CYS-276 is required for the second of two successive oxidations.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12682078 2003 Specific protein-1 is a universal regulator of UDP-glucose dehydrogenase expression: its positive involvement in transforming growth factor-beta signaling and inhibition in hypoxia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10973831 2000 Human UDP-glucose dehydrogenase gene: complete cloning and transcription start mapping.
10575217 1999 Assignment of the UGDH locus encoding UDP-glucose dehydrogenase to human chromosome band 4p15.1 by radiation hybrid mapping.
9850599 1998 cDNA cloning and expression analysis of the human UDPglucose dehydrogenase.
9737970 1998 Molecular cloning and characterization of the human and mouse UDP-glucose dehydrogenase genes.