Property Summary

NCBI Gene PubMed Count 40
PubMed Score 124.16
PubTator Score 214.23

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (4)

Gene RIF (30)

PMID Text
25535133 GCS was upregulated in colorectal carcinoma tissues compared to control tissues.
24960545 We found upregulation of specific sphingolipid enzymes, namely sphingomyelin synthase 1 (SMS1), sphingomyelinase 3 (SMPD3), and glucosylceramide synthase (GCS) in the endometrium of endometriotic women.
24510559 Glucosylceramide synthase mRNA were reduced by 62%.
24456584 Our data demonstrates a correlation between the expression of the GCS protein and ER-positive/HER-2 negative breast cancer
24342307 GCS was upregulated in PTCs and might be an independent factor affecting prognosis.
23913449 our work indicates that some UGCG polymorphisms are modifying factors in the severity of GD.
23555901 The results thus show that ARF6 regulates neuronal differentiation through an effect on glucosylceramide synthase and glucosylceramide levels.
23133636 DOX could modulate the expression of GCS through the Sp1 site of GCS promoter in ERalpha-positive breast cancer cells
22936806 Ceramide glycosylation catalyzed by glucosylceramide synthase is important for cancer stem cells in drug resistance and tumorigenesis.
22270805 The authors conclude that hepatitis C virus proteins, especially NS5A and NS5B, have positive effects on the expression of human GlcT-1.
21756066 Data show that nilotinib induces apoptosis through upregulating ceramide synthase genes and downregulating SK-1 in CML cells in addition to inhibition of BCR/ABL.
21617856 GCS overexpression was highly associated with ER-positive and HER2-positive breast cancer with metastasis.
21558327 GlcT-1 is up-regulated at the mRNA and protein levels during the course of U937 differentiation, resulting in increased amounts of GlcCer.
21380926 inhibition of the GCS gene affects the expression of MDR1 mRNA and P-gp function.
21278235 Data show that GCS silencing increased the levels of phosphorylated p53 and p53-responsive genes.
20843709 Data indicate that a high expression of glucosylceramide synthase (GCS) seemed to be an indicator of poor prognosis.
20540746 study demonstrates, for the first time, that GCS upregulates MDR1 expression modulating drug resistance of cancer. GSLs, in particular globo series GSLs mediate gene expression of MDR1 through cSrc and beta-catenin signaling pathway
20533270 Positive correlation was detected between the expression of GCS and MDR1 mRNA in K562/A02 cells and MDR1 mRNA expression was down regulated after silencing the GCS gene expression.
19693666 GCSshRNA could efficiently suppress GCS and MDR1 expression in vitro and in vivo and these findings may be used as one of the methods to reverse multidrug resistance in breast cancer
18560890 High glucosylceramide synthase is associated with breast cancer.
18155680 Western analysis for glucosylceramide synthase showed a significant decrease in Alzheimer disease brain consistent with the hypothesis that enzyme dysfunction contributes to neuronal decay.
17709137 it is suggested that a high level of GCS in leukemia is possible contributed to multidrug resistance of leukemia cells.
16500619 the reticulon family member RTN-1C has been expressed and purified in Escherichia coli and its molecular structure has been analysed by fluorescence and Circular Dichroism spectroscopy
15747776 10 genes were down-regulated following treatment of the T-ALL cells with 0.15 and 1.5 microg/mL of metal ores at 72 h. Transferase activity, transferring glycol groups
15661399 p-gp confers resistance to ceramide-induced apoptosis, with modulation of the ceramide-glucosylceramide pathway GCS making a marked contribution to this resistance
15263008 glucosylceramide synthase is not solely responsible for drug resistance in cancer cells
14766899 inhibition of glucosylceramide synthase led to increased CER galactosylation and protected U937 and HL-60 cells from DNR-induced apoptosis
12873973 Glucosylceramide synthase and its functional interaction with RTN-1C regulate chemotherapeutic-induced apoptosis in neuroepithelioma cells.
12489486 Observational study of gene-disease association. (HuGE Navigator)
11915344 serve as negative regulator for ceramide

AA Sequence

MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNL      1 - 70
ETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLI     71 - 140
WICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTG    141 - 210
MSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLR    211 - 280
INMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYA    281 - 350
VAWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV                              351 - 394
//

Text Mined References (42)

PMID Year Title
25535133 2014 Expression and significance of glucosylceramide synthase in colorectal carcinoma tissues.
24960545 2014 Dysregulated sphingolipid metabolism in endometriosis.
24510559 2014 [NF-? B mediates the effect of glucosylceramide synthase on P-glycoprotein modulation in a drug-resistance leukemia cell line].
24456584 2014 Expression of glucosylceramide synthase in invasive ductal breast cancer may be correlated with high estrogen receptor status and low HER-2 status.
24342307 2013 Upregulation of glucosylceramide synthase protein in papillary thyroid carcinoma.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23913449 2013 Characterization of variants in the glucosylceramide synthase gene and their association with type 1 Gaucher disease severity.
23555901 2013 ARF6 regulates neuron differentiation through glucosylceramide synthase.
23133636 2012 Doxorubicin influences the expression of glucosylceramide synthase in invasive ductal breast cancer.
22936806 2012 Ceramide glycosylation by glucosylceramide synthase selectively maintains the properties of breast cancer stem cells.
22270805 2012 HCV NS5A and NS5B enhance expression of human ceramide glucosyltransferase gene.
21756066 2011 Roles of ceramide synthase and ceramide clearence genes in nilotinib-induced cell death in chronic myeloid leukemia cells.
21617856 2011 Glucosylceramide synthase, a factor in modulating drug resistance, is overexpressed in metastatic breast carcinoma.
21558327 2011 Up-regulation of ceramide glucosyltransferase during the differentiation of U937 cells.
21380926 2011 The effect of glucosylceramide synthase on P-glycoprotein function in K562/AO2 leukemia drug-resistance cell line.
21278235 2011 Suppression of glucosylceramide synthase restores p53-dependent apoptosis in mutant p53 cancer cells.
20843709 Up-regulation of glucosylceramide synthase in urinary bladder neoplasms.
20540746 2010 Glucosylceramide synthase upregulates MDR1 expression in the regulation of cancer drug resistance through cSrc and beta-catenin signaling.
20533270 2010 [Study on the correlation of GCS and MDR1 genes in inducing multidrug resistance in human K562/A02 cell line].
19693666 2010 Targeting glucosylceramide synthase downregulates expression of the multidrug resistance gene MDR1 and sensitizes breast carcinoma cells to anticancer drugs.
18560890 2009 Prognostic relevance of glucosylceramide synthase (GCS) expression in breast cancer.
18155680 2008 Glucosylceramide synthase decrease in frontal cortex of Alzheimer brain correlates with abnormal increase in endogenous ceramides: consequences to morphology and viability on enzyme suppression in cultured primary neurons.
17709137 2008 Overexpression of glucosylceramide synthase in associated with multidrug resistance of leukemia cells.
16500619 2006 Cloning, expression, and preliminary structural characterization of RTN-1C.
15747776 2003 Dose-dependent transcriptome changes by metal ores on a human acute lymphoblastic leukemia cell line.
15661399 2005 P-glycoprotein is implicated in the inhibition of ceramide-induced apoptosis in TF-1 acute myeloid leukemia cells by modulation of the glucosylceramide synthase pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15263008 2004 Inhibition of glucosylceramide synthase does not reverse drug resistance in cancer cells.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14766899 2004 Cytoprotective effect of glucosylceramide synthase inhibition against daunorubicin-induced apoptosis in human leukemic cell lines.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12873973 2003 Glucosylceramide synthase and its functional interaction with RTN-1C regulate chemotherapeutic-induced apoptosis in neuroepithelioma cells.
12489486 2002 Polymorphisms in glucosylceramide (glucocerebroside) synthase and the Gaucher disease phenotype.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11915344 2002 [Role of glucosylceramide synthase as negative regulator for ceramide].
11335714 2001 Role of ceramide in mediating the inhibition of telomerase activity in A549 human lung adenocarcinoma cells.
10945987 2000 Glucosylceramide synthase does not attenuate the ceramide pool accumulating during apoptosis induced by CD95 or anti-cancer regimens.
9605861 1997 Assignment of a UDP-glucose:ceramide glucosyltransferase gene (UGCG) to human chromosome band 9q31 by in situ hybridization.
9545298 1998 Up-regulation of glucosylceramide synthase expression and activity during human keratinocyte differentiation.
8901638 1996 Expression cloning of a cDNA for human ceramide glucosyltransferase that catalyzes the first glycosylation step of glycosphingolipid synthesis.
8643456 1996 Expression cloning of a cDNA for human ceramide glucosyltransferase that catalyzes the first glycosylation step of glycosphingolipid synthesis.
1533793 1992 A rapid and simple assay method for UDP-glucose:ceramide glucosyltransferase.