Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.08
PubTator Score 2.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Heart disease 288 0.0 3.0
Disease Target Count Z-score Confidence
Subacute sclerosing panencephalitis 11 3.477 1.7

Expression

Synonym

Accession Q6NVU6 A4D2E4 A8K8V2 B6ZDG6 Q9BXP6 UfSP1
Symbols UFSP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MGDKPPGFRGSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGPVMVGGDADAR      1 - 70
SKALLGVCVGSGTEAYVLVLDPHYWGTPKSPSELQAAGWVGWQEVSAAFDPNSFYNLCLTSLSSQQQQRT     71 - 140
LD                                                                        141 - 142
//

Text Mined References (12)

PMID Year Title