Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.08
PubTator Score 2.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Heart disease 306 0.0 3.0
Disease Target Count Z-score Confidence
Subacute sclerosing panencephalitis 11 3.477 1.7

Expression

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MGDKPPGFRGSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGPVMVGGDADAR      1 - 70
SKALLGVCVGSGTEAYVLVLDPHYWGTPKSPSELQAAGWVGWQEVSAAFDPNSFYNLCLTSLSSQQQQRT     71 - 140
LD                                                                        141 - 142
//

Text Mined References (12)

PMID Year Title