Property Summary

NCBI Gene PubMed Count 23
PubMed Score 26.71
PubTator Score 12.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.771 1.5e-03
medulloblastoma 1.100 1.3e-02
medulloblastoma, large-cell 1.500 1.4e-04
active Crohn's disease 1.005 2.3e-02
progressive supranuclear palsy -1.300 5.6e-03

Gene RIF (9)

PMID Text
25219498 ASC1 is a target for ufmylation and that UFBP1 is an essential component for ASC1 ufmylation.
24966333 binding of ATP to Uba5 approximately Ufm1 thioester was required for efficient transfer of Ufm1 from Uba5 to Ufc1 via transthiolation.
24915089 results of an in vitro truncation assay suggest that Uba5 residues 57-363 comprise the minimal fragment required for the high-efficiency activation of Ufm1
24893112 transcription downregulation of the Ufm1 and FAT10 conjugation system in liver Mallory-Denk bodies formation
24726913 NCAM140 interacts with ufc1 and its trafficking and endocytosis is upregulated in the presense of Ufm1.
24603482 Thus, UfSP2 proteins have protease- and Ufm1-independent functions in GPCR biogenesis.
23152784 the Ufm1 system plays a critical role in vesicle trafficking, and its inhibition may lead to protein overload in the ER and UPR activation.
20018847 A novel type of E3 ligase for the Ufm1 conjugation system.
16527251 The solution structure and dynamics of human Ufm1 (hsUfm1) by nuclear magnetic resonance spectroscopy was analysed.

AA Sequence

MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH      1 - 70
GSELRIIPRDRVGSC                                                            71 - 85
//

Text Mined References (24)

PMID Year Title
26872069 2016 UBA5 Mutations Cause a New Form of Autosomal Recessive Cerebellar Ataxia.
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
24966333 2014 Mechanistic study of Uba5 enzyme and the Ufm1 conjugation pathway.
24915089 2014 Characterization, crystallization and preliminary X-ray crystallographic analysis of the Uba5 fragment necessary for high-efficiency activation of Ufm1.
24893112 2014 Ufmylation and FATylation pathways are downregulated in human alcoholic and nonalcoholic steatohepatitis, and mice fed DDC, where Mallory-Denk bodies (MDBs) form.
24726913 2014 Cytoplasmic domain of NCAM140 interacts with ubiquitin-fold modifier-conjugating enzyme-1 (Ufc1).
24603482 2014 An ER complex of ODR-4 and ODR-8/Ufm1 specific protease 2 promotes GPCR maturation by a Ufm1-independent mechanism.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23152784 2012 Transcriptional regulation of the Ufm1 conjugation system in response to disturbance of the endoplasmic reticulum homeostasis and inhibition of vesicle trafficking.
21269460 2011 Initial characterization of the human central proteome.
20018847 2010 A novel type of E3 ligase for the Ufm1 conjugation system.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16527251 2006 Solution structure and dynamics of Ufm1, a ubiquitin-fold modifier 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15071506 2004 A novel protein-conjugating system for Ufm1, a ubiquitin-fold modifier.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.