Property Summary

NCBI Gene PubMed Count 36
PubMed Score 53.50
PubTator Score 50.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 5.6e-03
pancreatic ductal adenocarcinoma liver m... -1.306 1.5e-02
lung cancer 1.100 3.3e-02
ovarian cancer 2.000 8.5e-06
Breast cancer 1.200 2.5e-07

 MGI Phenotype (1)

Gene RIF (21)

PMID Text
26112410 The study revealed a regulatory role of the p97-Npl4-Ufd1 complex in regulating a partial degradation of the NF-kappaB subunit p100.
24429874 p97-Ufd1-Npl4 is an integral part of G2/M checkpoint signaling and thereby suppresses chromosome instability.
24248593 Data indicate that the p97-UFD1L-NPL4 protein complex specifically associates with ubiquitinated IkappaBalpha via the interactions between p97 and the SCF(beta-TRCP) ubiquitin ligase.
24019527 In coordination with the P97-UFD1-NPL4 complex (P97(UFD1/NPL4)), NUB1L promotes transfer of NEDD8 to proteasome for degradation.
23623450 This study demonistrated that UFD1L may participate in the core cognitive deficits observed in schizophrenia.
23293021 Data indicate that Npl4-Ufd1 heterodimer is required for VCP-FAF1 interaction.
22763378 increased corpus callosum volume in children with 22q11DS is associated with UFD1L polymorphism.
21571647 Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER) stress response to cell cycle control
21486945 Data establish Cdc48/p97-Ufd1-Npl4 as a crucial negative regulator of Aurora B early in mitosis of human somatic cells and suggest that the activity of Aurora B on chromosomes needs to be restrained to ensure faithful chromosome segregation.
20702414 Data suggest that the human cytomegalovirus dislocation reaction in US2 cells is independent of the p97 cofactor Ufd1-Npl4, and different retrotranslocation mechanisms can employ distinct p97 ATPase complexes to dislocate substrates.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20471029 This study suggested that AA genotype of UFD1L gene, which is involved in neurodevelopmental processes, may contribute to early-onset schizophrenia. Therefore, rs5992403 polymorphism may not be a risk factor for schizophrenia.
20471029 Observational study of gene-disease association. (HuGE Navigator)
20442859 The VCP-UFD1L-NPL4 complex is required for HIV-1 Vpu-induced CD4 degradation in the ER-associated degradation pathway. The ATPase activity of VCP and ubiquitin binding to UFD1L are important for CD4 degradation by Vpu
18586029 This favors the model where the Ufd1-Npl4 dimer forms a regulatory gate at the exit from the retrotranslocone, rather than actively promoting retrotranslocation like the p97VCP ATPase.
18270977 allelic associations of the UFD1L locus identified; 4-SNP haplotype analysis showed strong association with schizophrenia; possibility that a disease-resistant variant may be carried by two or more haplotypes due to frequent recombination during meiosis.
18270977 Observational study of gene-disease association. (HuGE Navigator)
17681147 This study identifies Ufd1 as a cofactor of gp78, reveals an unappreciated function of Ufd1 in the ubiquitination reaction during endoplasmic reticulum -associated degradation, and illustrates that Ufd1 plays a critical role in cholesterol metabolism.
17331469 Ufd1-nuclear protein localization 4 is a negative regulator of retrotranslocation, delaying the retrotranslocation of endoplasmic reticulum-associated degradation substrates independently of its association with VCP
12910480 Ufd1l is localized around the nucleus and it does not interfere with Fas-and ceramide-mediated apoptosis.
11979512 a functional analysis of its 5' regulatory region

AA Sequence

MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLT      1 - 70
NKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKA     71 - 140
VLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERQVQHEEST    141 - 210
EGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKK    211 - 280
VEEDEAGGRFVAFSGEGQSLRKKGRKP                                               281 - 307
//

Text Mined References (44)

PMID Year Title
26112410 2015 The Transitional Endoplasmic Reticulum ATPase p97 Regulates the Alternative Nuclear Factor NF-?B Signaling via Partial Degradation of the NF-?B Subunit p100.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
24429874 2014 The p97-Ufd1-Npl4 ATPase complex ensures robustness of the G2/M checkpoint by facilitating CDC25A degradation.
24248593 2014 The p97-UFD1L-NPL4 protein complex mediates cytokine-induced I?B? proteolysis.
24089527 2013 Caveolin-1 interacts with Derlin-1 and promotes ubiquitination and degradation of cyclooxygenase-2 via collaboration with p97 complex.
24019527 2013 NEDD8 ultimate buster-1 long (NUB1L) protein promotes transfer of NEDD8 to proteasome for degradation through the P97UFD1/NPL4 complex.
23623450 2013 Polymorphisms in schizophrenia candidate gene UFD1L may contribute to cognitive deficits.
23293021 2013 Complex of Fas-associated factor 1 (FAF1) with valosin-containing protein (VCP)-Npl4-Ufd1 and polyubiquitinated proteins promotes endoplasmic reticulum-associated degradation (ERAD).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22763378 2012 Increased corpus callosum volume in children with chromosome 22q11.2 deletion syndrome is associated with neurocognitive deficits and genetic polymorphisms.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21571647 2011 Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum (ER) stress response to cell cycle control.
21486945 2011 Cdc48/p97-Ufd1-Npl4 antagonizes Aurora B during chromosome segregation in HeLa cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20702414 2010 The p97 ATPase dislocates MHC class I heavy chain in US2-expressing cells via a Ufd1-Npl4-independent mechanism.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20471029 2010 The UFD1L rs5992403 polymorphism is associated with age at onset of schizophrenia.
20414249 2010 Imbalances in p97 co-factor interactions in human proteinopathy.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18775313 2008 UBXD7 binds multiple ubiquitin ligases and implicates p97 in HIF1alpha turnover.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18586029 2008 Analysis of Npl4 deletion mutants in mammalian cells unravels new Ufd1-interacting motifs and suggests a regulatory role of Npl4 in ERAD.
18270977 2008 A family- and population-based study of the UFD1L gene for schizophrenia.
17681147 2007 Ufd1 is a cofactor of gp78 and plays a key role in cholesterol metabolism by regulating the stability of HMG-CoA reductase.
17331469 2007 Ufd1-Npl4 is a negative regulator of cholera toxin retrotranslocation.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12910480 2003 Analysis of intracellular distribution and apoptosis involvement of the Ufd1l gene product by over-expression studies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11979512 2002 Functional characterization of the 5' flanking region of human ubiquitin fusion degradation 1 like gene (UFD1L).
11574150 2001 Cloning and characterization of the gene encoding human NPL4, a protein interacting with the ubiquitin fusion-degradation protein (UFD1L).
11076863 2000 DNA cloning using in vitro site-specific recombination.
10591208 1999 The DNA sequence of human chromosome 22.
10024240 1999 A molecular pathway revealing a genetic basis for human cardiac and craniofacial defects.
9540831 1998 Structure and expression of the human ubiquitin fusion-degradation gene (UFD1L).
9063746 1997 UFD1L, a developmentally expressed ubiquitination gene, is deleted in CATCH 22 syndrome.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.