Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.02
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 5.7e-05
Multiple myeloma 1327 2.4e-04
diabetes mellitus 1663 1.1e-03
Waldenstrons macroglobulinemia 764 1.0e-02
Disease Target Count Z-score Confidence
Alcoholic hepatitis 3 3.122 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.101 1.0e-02
Multiple myeloma 1.565 2.4e-04
diabetes mellitus -1.400 1.1e-03
ovarian cancer 2.200 5.7e-05

Gene RIF (6)

PMID Text
25449213 UFC1 interact with the mRNA stabilizing protein HuR to increase levels of beta-catenin in hepatocellular carcinoma.
25213431 Autoantibodies binding to Ufc1 were found in 19 of 29 patients (66%) with active mycobacterial infections.
25084390 Uba5 residues 364-404 were demonstrated to be necessary for the transthiolation of Ufm1 to Ufc1, and Uba5 381-404 was identified to be the minimal region for Ufc1 recognition
24726913 NCAM140 interacts with ufc1 and its trafficking and endocytosis is upregulated in the presense of Ufm1.
19101823 The structure of human Ufc1 was solved by using both NMR spectroscopy and X-ray crystallography
15071506 Identification of a novel enzyme called UFC1 for Ufm1-conjugating enzyme 1.

AA Sequence

MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCW      1 - 70
YIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMAL     71 - 140
GLGPWLAVEIPDLIQKGVIQHKEKCNQ                                               141 - 167
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25902260 2015 Autism and Intellectual Disability-Associated KIRREL3 Interacts with Neuronal Proteins MAP1B and MYO16 with Potential Roles in Neurodevelopment.
25449213 2015 The long intergenic noncoding RNA UFC1, a target of MicroRNA 34a, interacts with the mRNA stabilizing protein HuR to increase levels of ?-catenin in HCC cells.
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
25213431 2015 Autoantibodies binding to ubiquitin-fold modifier-conjugating enzyme 1 (Ufc1) and pleckstrin homology domain containing, family G (with RhoGef domain) member 2 (Plekhg2) are associated with mycobacterial infections.
25084390 2014 Characterization, crystallization and preliminary X-ray crystallographic analysis of the human Uba5 C-terminus-Ufc1 complex.
24726913 2014 Cytoplasmic domain of NCAM140 interacts with ubiquitin-fold modifier-conjugating enzyme-1 (Ufc1).
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23152784 2012 Transcriptional regulation of the Ufm1 conjugation system in response to disturbance of the endoplasmic reticulum homeostasis and inhibition of vesicle trafficking.
21269460 2011 Initial characterization of the human central proteome.
20018847 2010 A novel type of E3 ligase for the Ufm1 conjugation system.
19101823 2009 NMR and X-RAY structures of human E2-like ubiquitin-fold modifier conjugating enzyme 1 (UFC1) reveal structural and functional conservation in the metazoan UFM1-UBA5-UFC1 ubiquination pathway.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17825256 2007 Crystal structure of Ufc1, the Ufm1-conjugating enzyme.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16132835 2005 GFT NMR based resonance assignment for the 21 kDa human protein UFC1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15071506 2004 A novel protein-conjugating system for Ufm1, a ubiquitin-fold modifier.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.