1. Home
  2. Targets
  3. transfer/carrier protein
  4. mitochondrial carrier protein
  5. ribosomal protein
  6. Mitochondrial uncoupling protein 2

Tbio Mitochondrial uncoupling protein 2

UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 290
PubMed Score 1022.67
PubTator Score 597.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Hyperinsulinemic hypoglycemia 17 0.0 5.0

Expression

  Differential Expression (33)

Disease log2 FC p
Rheumatoid Arthritis -2.200 4.0e-03
Waldenstrons macroglobulinemia 1.134 5.6e-03
malignant mesothelioma 7.000 3.0e-10
Barrett's esophagus 1.300 2.3e-02
esophageal adenocarcinoma 2.100 1.8e-02
psoriasis -1.200 6.0e-04
cutaneous lupus erythematosus 1.700 9.6e-04
glioblastoma 2.900 1.1e-04
osteosarcoma -2.722 3.5e-04
posterior fossa group B ependymoma 1.800 1.5e-08
medulloblastoma 1.500 1.6e-04
cystic fibrosis -2.759 4.7e-06
astrocytoma 3.000 1.1e-02
atypical teratoid / rhabdoid tumor 2.300 1.5e-07
medulloblastoma, large-cell 2.700 4.5e-06
primitive neuroectodermal tumor 1.400 4.1e-03
Duchenne muscular dystrophy 1.605 7.5e-09
X-linked recessive Emery-Dreifuss muscul... 1.389 4.7e-03
Becker muscular dystrophy 1.152 1.0e-03
juvenile dermatomyositis 1.191 6.2e-09
acute quadriplegic myopathy 1.059 6.3e-04
limb girdle muscular dystrophy 2A 1.108 2.2e-05
adrenocortical carcinoma -1.285 3.3e-02
tuberculosis 1.500 3.6e-06
intraductal papillary-mucinous neoplasm ... 1.900 7.7e-03
pediatric high grade glioma 1.900 4.1e-06
pilocytic astrocytoma 1.300 1.1e-04
subependymal giant cell astrocytoma 2.313 4.6e-03
invasive ductal carcinoma 1.685 3.1e-03
non-inflammatory breast cancer 1.300 6.1e-03
gastric carcinoma 1.500 4.2e-02
ulcerative colitis 1.900 1.4e-03
ovarian cancer 3.100 2.7e-06

Synonym

Accession P55851 Q4PJH8 Q53HM3 UCP 2
Symbols UCPH
BMIQ4
SLC25A8

Gene

UCP2

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (10)

 GO Function (1)

 GO Component (2)

 GO Process (17)

See all...

 Compartment GO Term (35)

See all...

 MGI Phenotype (8)

 HCA RNA Cell Line (54)

See all...

Pathway (11)

See all...

Protein-protein Interaction (25)

UQCRQ   UQCR11   SLC25A14   SLC25A27   UQCRH   UQCRB   UQCRC2   UQCRC1   UQCRFS1   UCP3   NDUFA11   NDUFB11   UQCR10   AMY1C   ZG16B   CST4   CST2   FLG   SERPINB4   SERPINB3   MUC7   NCCRP1   PIGR   IGHA2   CRNN  

Gene RIF (325)

PMID Text
26642043 GTPBP3 plays a role in the regulation of UCP2 protein through AMPK signaling.
26526553 Findings in 20 242 individuals suggest that UCP2 gene polymorphisms may cause liver dysfunction through the interaction with body fat rather than alcohol intake.
26450681 Estrogens may increase mitochondrial reactive oxygen species production by repressing uncoupling proteins including UCP2.
26402942 Polymorphism of UCP2 gene is being associated with obesity and diabetes mellitus type 2 among residents of the Moscow Region.
26356408 UCP2 is expressed in human cumulus cells.
26275882 UCP2 as a selective modulator of single channel MCU dependent mitochondrial Ca2+ inward current.
26218518 Data reported here suggest that the UCP2 -866A/55Val/Ins haplotype is associated with an increased risk for DKD and with a lower eGFR in T2DM patients
26181366 ectopic overexpression of UCP2 in a HCC cell line with low endogenous UCP2 expression, HLE, significantly decreased mitochondrial superoxide induction by the anti-cancer drug GEM.
26107945 exogenous expression of miR133a or knockdown of UCP-2 in MCF-7/Dox cells can sensitize their reaction to the treatment of Doxorubicin
26082030 Dissipation of the proton gradient by Ucp2 is not the only determinant of the phagocytic capacity and that anion transfer or nucleotide binding by Ucp2 is also essential for Ucp2-mediated engulfment of apoptotic cells.
25976474 In the face of high glucose threat, mitochondrial UCP2 gene expression is regulated by miR-2909 and AATF.
25960046 Higher UCP2 expression corresponded with a poorer prognosis in breast cancer patients.
25910810 UCP2 may function as a sensor and negative regulator of mitochondrial ROS production in response to hyperglycemia.
25789405 the outcome of this study provides a deeper and more detailed molecular image of UCP2's ion transport mechanism.
25773007 72% of the patients had risk combination of PGC-1alpha XA and UCP2-866 XA genotypes.
25512910 UCP2 was associated with ATP synthesis during PA-induced autophagy. In conclusion, increasing UCP2 expression in hepatoma cells may contribute to cell autophagy and antiapoptotic as result of fatty acid injury
25482405 We conclude that UCP2 neither mediates palmitate-induced mitochondrial ROS generation and the associated cell loss, nor protects against these deleterious effects. Instead, UCP2 dampens palmitoleate protection against palmitate toxicity.
25431415 The UCP2 45-bp I/D polymorphism is associated with overall adiposity among Malaysian women.
25407516 EPA or DHA pre-treatment inhibits the DOX-induced decrease in UCP2 expression, increase in ROS production
25396419 UCP2 may be implicated in the pathogenesis of type 2 diabetes mellitus and diabetic retinopathy in Chinese population.
25351290 UCP2 -866 A/A genotype is associated with increased hepatic UCP2 expression and reduced risk of nonalcoholic steatohepatitis, particularly in subjects with normal fasting glucose.
25140781 UCP2 plays a regulatory role in the activation of p38 MAPK and NF-kappaB and the expression of downstream inflammatory mediators in H9C2 cells stimulated with septic serum.
25081806 The UCP-2 exon 8 del/ins polymorphism was associated with higher degree of obesity, insulin resistance, dyslipideamia and lower adjusted metabolic rate.
24965893 Data suggest a hUCP2-PKA axis that controls mitochondrial dynamics and survival in dopaminergic neurons exposed to rotenone implicating a novel therapeutic strategy in modifying the progression of Parkinson's disease pathogenesis
24853548 Mitochondrial retrograde signaling mediated by UCP2 inhibits cancer cell proliferation and tumorigenesis.
24804925 The meta-analysis detected a significant association between the UCP2-866G/A, Ins/Del, Ala55Val and UCP3-55C/T polymorphisms and BMI mean differences.
24752406 Genotype and allele distributions of UCP1, UCP2 and UCP3 polymorphisms did not differ significantly between obese and non-obese Type 2 Diabetes Mellitus patients.[Meta-analysis]
24741957 Genetic polymorphisms of ADRB3, FTO, and UCP2 genes are associated with overweight in athletes of winter sports.
24659521 Exercise-mediated changes in insulin resistance and adiponectin levels may be affected by genotypes in the 3'UTR I/D polymorphism in UCP2 in postmenopausal obese women
24642125 The ability to rapidly upregulate UCP2 protein expression may be important in protecting endothelial cells from excessive generation of potentially damaging reactive oxygen species.
24564667 These mechanisms, together with impaired autocrine insulin function belong to important causes of Type 2 diabetes etiology. [review]
24440978 In various tumor types protein levels of UCP2 are significantly higher in tumor tissues than that in the adjacent normal tissues.
24395786 during cell respiration, UCP2 transports C4 metabolites out of mitochondria, regulating glucose and glutamine oxidation
24304655 Suggest that overexpression of UCP2 can ameliorate salt-induced vascular dysfunction.
24251413 The UCP2 expression is upregulated in response to elevated reactive oxygen species generation in affected mutation carriers and that UCP2 mRNA levels might, therefore, serve as markers of disease status in LRRK2-associated PD(Parkinson's disease ).
24142693 Ligand stimulation of non-overexpressed ERBB2 transiently removes UCP2 and paradoxically reduces the mitochondrial membrane potential, oxygen consumption, and OXPHOS on a signaling time scale.
24141050 neuroprotective role of UCP2 in neurodegeneration is disease-specific and the disease caused by mutant SOD1 cannot be ameliorated by UCP2 overexpression.
24065674 Based on our case-control study and meta-analysis, we conclude that UCP2 Ala55Val and -866G/A polymorphisms are not significantly associated with type 2 diabetes risk in the Chinese population.
24041971 participates in the pathogenesis of PD via modulating astrocytic ER stress and NLRP3 inflammasome activation.
23988448 Overexpression of miR-133a-1 increases Caspase-1 p10 and IL-1beta p17 cleavage, concurrently suppressing mitochondrial uncoupling protein 2 (UCP2).
23835672 The decreased UCP2 expression and increased ZO-1 expression suggest that the oxidative stress-induced mitochondrial dysfunction and tight junction formation may play pivotal roles in the progress of NVG.
23639961 Single nucleotide polymorphisms in the UCP2 - 866G/A and UCP3 - 55C/T promoter region are not associated with coronary artery disease in young South African Indian males.
23621569 A single nucleotide polymorphism (SNP) in UCP-2 is not significantly associated with recurrence of diabetic ischemic stroke.
23560041 The UCP2 -866G/A polymorphism may be a risk factor for susceptibility to obesity in subjects of European descent, but not in individuals of Asian descent. (Meta-analysis)
23537071 These findings support the hypothesis that A55V polymorphism is associated with UCP2 functional alterations that increase the risk of cardiovascular events in patients with previous coronary artery disease and dysglycemia.
23521650 This study demonistrated that Polymorphisms in uncoupling protein genes UCP2 is not associated with HIV-associated sensory neuropathy in African individuals.
23505621 Insertion allele (I) of the I/D UCP2 gene was favourable in obtaining higher VOmax (maximum oxygen uptake)level and might be considered as endurance-related allele
23434936 Data suggest that nutrient depletion up-regulates expression of UCP2 and glucagon in islet alpha-cells (in cultured islets); further, Ucp2 appears necessary for normal alpha-cell glucose sensing and maintenance of euglycemia.
23432701 Common polymorphisms of the UCP-2 gene might influence the propensity to overweight/obesity in Hungarian children.
23412863 The subjects with the T/T genotypes of UCP3-55C/T or UCP2 A55V had lower total energy expenditure than those with other genotypes.
23365654 A significant association has been found between the UCP3 -55C/T polymorphisms and increased susceptibility for type 2 diabetes mellitus in Asians.
23314523 UCP2 I/D polymorphism showed an association with obesity.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
23147265 meta-analysis suggested that UCP2 -866G/A polymorphism was associated with obesity. The A allele may be an important protective factor for obesity in Europeans, but not in Asians.
23101559 The study found UCP2 D/I to be associated with change in BMI by altering the effect of change in energy expenditure on change in BMI.
23088859 Data suggest that UCP2 is up-regulated during placentation (24-41 weeks gestation); expression of UCP2 is positively correlated with placental weight. UCP2 expression was lower in placentas of infants who were small for gestational age.
23088537 These findings support the potential use of a moderately (i.e., approximately one-half of the available lysine or hydroxylysine residues being crosslinked) crosslinked CDM as a contraction-free biomaterial for cartilage tissue engineering.
23069211 Manipulation of UCP2 glutathionylation status can serve as a therapeutic strategy for cancer treatment.
23068098 This putative novel UCP2 activity, evaluated by the use of UCP2-knockout transgenic animals, along with the known antioxidant defence systems, may provide additional protection from ROS in brain mitochondria.
23033381 the -3826A/G polymorphism is associated with DR in type 1 DM patients.
23008094 Increased ovarian UCP2 expression in response to T3 treatment in PCOS may alter pregnenolone synthesis by influencing P450scc expression, thus altering testosterone production.
22995745 Genetic polymorphisms within the UCP2 gene are associated with predisposition to recurrent miscarriage in non-obese women.
22847181 Low UCP-2 expression is associated with low treatment response in lung cancer.
22807616 Uncoupling protein 2 regulates glucagon-like peptide-1 secretion in L-cells
22733179 No association is found between UCP2-45-bp insertion/deletion and body mass index variation in the Chinese population.
22634308 These findings question an impact of moderately elevated UCP-2 levels in beta cells as seen in diabetes.
22613561 The A allele variant of UCP2 was associated with increased risk of ischemic stroke in Chinese diabetic women with type 2 diabetes
22568573 Uncoupling protein-2 45-base pair insertion/deletion polymorphism is not associated with severe obesity and weight loss in morbidly obese subjects
22533685 Report the importance of environmental settings in studying the involvement of UCP2 gene polymorphisms in the development of obesity in a Balinese population.
22524567 Neuronal UCP2 exhibits transmembrane chloride transport activity.
22490607 UCP2 could play a role as a determinant of the neurotoxicity mediated by NMDAR through a mechanism related to the unidentified interaction with the essential GluN1 subunit toward modulation of mitochondrial Ca(2+) levels in neurons
22349573 The UCP2 -866G-allele is associated with decreased insulin sensitivity in Danish subjects and is associated with obesity in a combined meta-analysis.
22292025 Over-expression of UCP2 has anti-apoptotic properties by inhibiting ROS-mediated apoptosis in A549 cells under hypoxic conditions.
22266335 Human UPC2 has a neuroprotective role in dopaminergic neurons in a Drosophila sporadic Parkinson disease model.
22241057 common genetic variation at the UCP3/2 gene locus is associated with training-related improvements in delta efficiency, an index of skeletal muscle performance
22134120 This is the first report suggesting that the presence of the -866A/55Val/Ins haplotype is associated with decreased UCP2 gene expression in human retina.
22085932 human pluripotent stem cells contain active mitochondria and require UCP2 repression for full differentiation potential.
22070905 This study demonistrated that DD genotype of UCP-2 might result in mitochondrial dysfunction, which is also a source of oxidative stress and contribute obsessive compulsive disorders.
22001364 The results of this study found that the UCP2 mRNA levels were significantly lower in patients with bipolar disorder and schizophrenia.
21935467 UCP2 is over-expressed in breast and many other cancers. UCP2 promotes tumorigenic properties in vitro and in vivo and genipin suppresses the tumor promoting function of UCP2.
21883184 Polymorphisms of the UCP2 gene (rs660339 and rs659366) were associated with central obesity.
21873561 Serological N-acetyl-glucosaminidase, telomere length, and the UCP2-886G>A variant are independent risk factors for type 2 diabetes.
21751002 UCP2 -866G/A polymorphism is unlikely to be associated with increased type 2 diabetes risk; UCP2 Ala55Val polymorphism may be risk factor for susceptibility to type 2 diabetes in individuals of Asian descent (Meta-Analysis)
21720911 The genetic variants in the ESR, FTO, and UCP2 genes may be considered as a screening tool prior to bariatric surgery to help clinicians predict weight loss or glycemic control outcomes for severely obese patients.
21613221 Letm1 and UCP2/3 independently contribute to two distinct, mitochondrial Ca(2+) uptake pathways in intact endothelial cells.
21584501 No association exists between the -866G/A polymorphism in the promoter of the UCP2 gene and Polycystic ovary syndrome.
21557918 In PCOS patients, there was a correlation between UCP-2 and CYP11A1 expression, which was significantly higher than in the control group.
21374988 The use of genipin in combination with VitE can increase mitochondrial membrane potential, increase UCO2 expression, and markedly relieve the adipose degeneration of liver cells.
21340542 A-IGF1R/Asp-IRS2/Val-UCP2 allele combination is associated with a decreased all-cause mortality risk and with an increased chance of longevity.
21266666 The result suggested that the polymorphism in uncoupling protein 2 may be a potential genetic risk factor for neural tube defects in a high-risk area of China.
21254885 We found a suggestive association between NOS3 (-786 T/C; G298A) and UCP2 (A55V) polymorphisms and power athletes in Italy.
21175267 The genotype and the allele frequencies of Ala55Val of the UCP2 gene showed a significant protective effect against the development of type 2 diabetes.
21128330 UCP2 is highly expressed in human colon cancer tissue and may be involved in colon cancer metastasis.
21074158 the UCP gene cluster variation (UCP2-UCP3) may not have a role in development of type 2 diabetes mellitus in women
21074158 Observational study of gene-disease association. (HuGE Navigator)
21029457 Study in type 2 diabetic patients shows a significant association of C-reactive protein levels with the G(-866)A polymorphism of UCP2 beyond the effect of major confounders.
21029457 Observational study of gene-disease association. (HuGE Navigator)
20937264 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20813684 UCP2 may play an important role in the regulation of macrophage activity and cytokine secretion to contribute to spontaneous abortion.
20804304 In the Iranian population, there are no associations between -866G/A polymorphism in the uncoupling protein 2 (UCP2)gene promoter with type 2 diabetes. In obese patients, the A allele showed some protective effect for obesity.
20804304 Observational study of gene-disease association. (HuGE Navigator)
20802238 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20608355 UCP2 plays an important protective role against oxidative stress damage to human sperm by diminishing reactive oxygen species production.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20595066 The UCP2 knockdown participates in the mechanism of action of cisplatin, thus providing evidence that targeting UCP2 may offer clinical benefit in the treatment of cancer.
20538960 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20427509 hypothyroidism is associated with a profound decrease in UCP2 mRNA expression. UCP2 is a determinant of fat oxidation pathways and may be involved in the changes seen in the metabolic pathways in thyroid disease.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20384434 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20359253 The results suggest that the UCP2 gene may contribute to weight loss and fat change in response to sibutramine therapy in obese Taiwanese patients.
20359253 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20332018 No indication for protonophoric reduction of mitochondrial membrane potential was found in UCP2 overexpressing HeLa cells and only little in HUVEC. ROS levels increased instead of being reduced in these cells.
20145583 An interaction between -866G>A and beta-blocker treatment was found in individuals with diabetes (P=0.002) but not those without (P=0.79).
20145583 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20142250 prostate cancer was inversely associated with the UCP2 rs660339 Val55 allele
20056920 Expression of UCP2 during disease processes associated with the generation of ROS, such as heart failure, could exacerbate defects in excitation contraction coupling and cause the loss of contractile function, enhancing arrhythmogenic potential.
19950601 The UCP2 gene mutation might be a risk factor of obesity in Chengdu area. However, this gene mutation may not be an impact factor on the alternation of gut bacteria.
19950601 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19946892 analysis of the nutritional and hormonal regulation of UCP2 and on its physiological roles [review]
19913121 Observational study of gene-disease association. (HuGE Navigator)
19908126 The -866 AA genotype and A allele of the UCP2 gene is associated with obesity and A allele associated with hyperinsulinemia in obese subjects.
19908126 Observational study of gene-disease association. (HuGE Navigator)
19895332 Observational study of gene-disease association. (HuGE Navigator)
19889414 The association of the UCP2 functional promoter variant with the leukocyte telomere length implies a link between mitochondrial production of reactive oxygen species and shorter telomere length in T2D.
19889414 Observational study of gene-disease association. (HuGE Navigator)
19876004 Observational study of gene-disease association. (HuGE Navigator)
19846869 these results suggest that UCP2 can regulate mast cell activation.
19833146 CNTF and IL6 polymorphisms in interaction with UCP2 polymorphisms had similar strong effects on weight gain in women and men.
19833146 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19769793 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19769793 Genetic variation in the UCP2-UCP3 gene cluster may act as a modifier increasing serum lipid levels and indices of abdominal obesity
19760975 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19753844 The -2723T/A, -1957G/A, -866G/A alleles, and ID 45 haplotype are associated with an increased risk of type 2 diabetes in a northwestern Colombian population.
19727213 The 866A/G polymorphism of UCP2 gene was not a risk factor for abdominal obesity.
19727213 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19681913 Data show that UCP2 haplotype [A Val Ins] seems to be an important risk factor associated with PDR in both type 2 and 1 diabetic groups.
19681913 Observational study of gene-disease association. (HuGE Navigator)
19680556 Observational study of gene-disease association. (HuGE Navigator)
19659999 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19653005 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19556617 In the prospective group 120 non-diabetic patients who were carriers of the G allele had significantly higher maximum blood glucose recordings than non-carriers. In the retrospective study 103 non-diabetic patients showed a similar relationship.
19556617 Observational study of gene-disease association. (HuGE Navigator)
19531977 Results contribute to explain the reduced cardiovascular risk associated with the A allele of the UCP2 -866G>A polymorphism.
19531977 Observational study of gene-disease association. (HuGE Navigator)
19527523 Diabetic patients in a post-myocardial infarction cohort with UCP2-866 AA/GA genotype have poorer survival and higher myeloperoxidase levels than their GG counterparts.
19527523 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19491387 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19413708 polymorphisms associated with fat metabolism, obesity and diabetes
19387457 UCP2 -866 G/A polymorphism was associated with chronic inflammatory diseases.
19387457 Observational study of gene-disease association. (HuGE Navigator)
19368944 acute insulin response to glucose is associated with the -55C/T UCP2 homozygous mutation and the presence of this mutation could alter postchallenge insulin concentration
19368944 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19155787 UCP2 polymorphisms are associated with heart rate variability in young and healthy states.
19155787 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19140314 Observational study of gene-disease association. (HuGE Navigator)
19137581 In our Irish study population, UCP2 polymorphisms did not influence neural tube defects risk.
19137581 Observational study of gene-disease association. (HuGE Navigator)
19065272 These results show for the first time a direct association between UCP2 amino acid alteration and human disease and highlight a role for mitochondria in hormone secretion.
19056576 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19039313 The UCP2-866G>A and UCP3-55C>T gene variants showed significant associations with BMI level, waist circumference, and body weight in the children but not in the adults.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18956255 Nonsynonymous rs660339 in the human UCP2 gene in men, and the haplotype (UCP3 rs2075577-UCP2 rs660339) in women might be good obesity markers.
18956255 Observational study of gene-disease association. (HuGE Navigator)
18940651 The results suggest that the del/del polymorphism of the UCP2 gene is not associated with lower resting energy expenditure in nondialyzed CKD patients
18940651 Observational study of gene-disease association. (HuGE Navigator)
18924534 Observational study of gene-disease association. (HuGE Navigator)
18846338 Down-regulation of the UCP-2 gene expression in steatotic hepatocytes could alleviate the ischemia-reperfusion injury of liver cells.
18839467 Observational study of gene-disease association. (HuGE Navigator)
18755175 Observational study of gene-disease association. (HuGE Navigator)
18720901 Observational study of genotype prevalence. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18593920 Microenvironment activation of highly conserved mammalian UCPs may facilitate the Warburg effect in the absence of permanent respiratory impairment.
18496642 The Ala55Val polymorphism of UCP2 was not associated with incident T2DM in the Atherosclerosis Risk cohort in Communities (ARIC).
18496642 Observational study of gene-disease association. (HuGE Navigator)
18460338 Subjects with a 45bp insertion allele of UCP2+3474 ins/del might have a higher risk of developing obesity, although the biological effects of this variant are not completely known.
18460338 Observational study of gene-disease association. (HuGE Navigator)
18426866 Observational study of gene-disease association. (HuGE Navigator)
18413749 Overexpression of UCP2 in HCT116 human colon cancer cells inhibits reactive oxygen species accumulation and apoptosis after exposure to chemotherapeutic agents.
18305572 Significant expression of UCP2 and UCP3 was observed also in cultured keratinocytes and fibroblasts.
18301432 neuroprotection in the thalamus correlated with a high expression of UCP2, which is neuroprotective in a number of models of neurodegenerative diseases
18301352 The -866 A/A genotype may contribute to reduced LDL particle size levels, a significant risk factor for the development of coronary artery disease.
18301352 Observational study of gene-disease association. (HuGE Navigator)
18242170 Observational study of gene-disease association. (HuGE Navigator)
18223008 Findings suggest a role of UCP2-UCP3 gene cluster haplotypes in diabetes; in particular, effects of the high-risk haplotypes were more apparent in overweight Caucasian women.
18223008 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18192542 The A allele of the -866G>A variant of UCP2 was associated with reduced risk of coronary artery disease in men with type 2 diabetes in a 6-year prospective study.
18192542 Observational study of gene-disease association. (HuGE Navigator)
18167556 Increased expression of UCP-2 and decreased expression of UCP-3 in humans with chronic hyperglycemia may contribute to impaired glucose-stimulated insulin secretion
18059082 Observational study of gene-disease association. (HuGE Navigator)
18031357 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18031357 body fat was reduced significantly less in the ValVal type compared with the other types (p=0.016), whereas the changes in lean body mass, protein, mineral, and water contents were not significantly different according to the Ala55Val polymorphism
18018477 The brain may respond to neuroprotection through the increased expression of UCP2 under ischemic conditions.
18006489 temperature heterogeneity in atherosclerotic plaques is at least in part attributed to UCP2 expression in macrophages. The heat generated might be used to detect unstable, macrophage-rich, atherosclerotic plaques via thermography.
17985659 Observational study of genotype prevalence. (HuGE Navigator)
17985659 a single nucleotide polymorphism in the promoter region of the UCP2 gene has a significant association with HDL cholesterol level in Iranian nonobese nondiabetic subjects
17894153 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17894153 Ala55Val polymorphism on UCP2 gene predicts greater weight loss in morbidly obese patients undergoing gastric banding.
17870627 Observational study of gene-disease association. (HuGE Navigator)
17718790 Observational study of gene-disease association. (HuGE Navigator)
17718790 the association of plasma fatty acids with the -866 G/A polymorphism of uncoupling protein 2 (UCP2) in obese children
17701054 comparison of risk genotype combinations of: UCP2-866GG, mtDNA 10398A and PGC1alpha p.Thr394Thr or p.Gly482Ser for NIDDM
17701054 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17666355 the expression of uncoupling protein-2 (UCP2) in the granular cell of women undergoing in vitro fertilization (IVF) and its role in embryo development
17601350 Observational study of gene-disease association. (HuGE Navigator)
17570749 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17555951 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17555951 Demonstrate an interaction between the UCP2 -866G>A variant and smoking to increase oxidative stress in diabetics.
17544366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17544366 UCP2-3 polymorphisms were important genetic factor for the very low calorie diet-induced reduction of body fat mass
17512314 Observational study of gene-disease association. (HuGE Navigator)
17512314 2 SNPs in UCP2, -866G>A and +4787C>T (A55V) that were tightly linked (r(2) = 0.97), were significantly associated with decreased HDL cholesterol levels in Korean women
17502873 UCP2 A55V variant might predispose to obesity and Val55 allele to confer population-attributable risk for 9.5% of obese disorders and increase insulin. V-A-T haplotype within UCP2-UCP3 gene cluster is significantly associated with obesity in Paiwanese.
17502873 Observational study of gene-disease association. (HuGE Navigator)
17463068 Observational study of genotype prevalence. (HuGE Navigator)
17463068 Link between UCP2 single-nucleotide polymorphism and multiple sclerosis and a slight relation with muscle mitochondrial haplotypes.
17462780 UCP-2 can possibly modify atherosclerotic processes initiated in vascular cells and agents that increase UCP-2 expression in vascular may prevent atherosclerosis.
17397545 Observational study of gene-disease association. (HuGE Navigator)
17351641 Results show that UCP2 is essential for mitochondrial Ca(2+) sequestration in response to cell stimulation under physiological conditions.
17342078 Observational study of gene-disease association. (HuGE Navigator)
17342078 These data suggest that the A55V polymorphism of the UCP2 gene directly affected the levels of leptin but not via an effect on insulin.
17316620 High UCP2 transcript levels were detected in reticulocytes and other maturating erythroid cells in mice exposed to hypoxia, and in umbilical cord blood of human neonates and peripheral blood of adults, suggesting involvement of UCP2 in erythropoiesis
17242157 human uncoupling proteins 1 and 2 are activated by polyunsaturated fatty acids in planar lipid bilayers
17240372 UCP2 is very unstable, with a half-life close to 30min, compared to 30h for its homologue UCP1, a difference that may highlight different physiological functions.
17170091 UCP2 overexpression can negatively impact proinsulin processing
17130180 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17066476 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17066476 These findings suggest that UCP2 and UCP4 have a modest but important involvement in the genetic etiology of schizophrenia.
17052689 In conclusion, our results provide correlative evidence for the "PPARgamma-->UCP2-->neuroprotection" cascade in ischemic brain injury.
16982633 Observational study of gene-disease association. (HuGE Navigator)
16982633 UCP2 may have a role in dissipating the excess energy of a high-glucose environment
16741267 Observational study of gene-disease association. (HuGE Navigator)
16644712 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16644712 Functional promoter variants UCP2 and UCP3 increase the prospective risk of type 2 diabetes, and is exacerbated by obesity.
16622580 Observational study of gene-disease association. (HuGE Navigator)
16567833 Observational study of gene-disease association. (HuGE Navigator)
16567833 UCP2 promoter gene polymorphism -866 G/A was significantly associated with nerve conduction slowing and vasomotor sympathetic functions suggesting higher UCP2 activity related to A allele has energy-depleting effect on peripheral nerve function in NIDDM
16562813 Observational study of gene-disease association. (HuGE Navigator)
16373902 Observational study of gene-disease association. (HuGE Navigator)
16373902 G-866A polymorphism in the UCP2 gene is associated with a reduced risk of diabetic neuropathy in type 1 diabetes.
16282353 The principal mechanisms regulating UCP2 gene expression are similar in rats and humans, being consistent with a role for UCP2 as a modulator of insulin secretion in humans.
16167150 Observational study of gene-disease association. (HuGE Navigator)
16167150 variation in UCP2 may play a role in energy metabolism, but this gene does not contribute significantly to the aetiology of type 2 diabetes and/or obesity in Pima Indians.
16054055 neuronal-specific expression of hUCP2 in adult flies decreases cellular oxidative damage and is sufficient to extend life span
16021520 Observational study of gene-disease association. (HuGE Navigator)
16021520 UCP2 promoter polymorphism may contribute to multiple sclerosis susceptibility by regulating the level of UCP2 protein in the central nervous and/or the immune systems.
15985484 Observational study of gene-disease association. (HuGE Navigator)
15959859 Observational study of gene-disease association. (HuGE Navigator)
15951317 Observational study of gene-disease association. (HuGE Navigator)
15910756 Our results suggest that the LEP and UCP2/UCP3 genes are unlikely to have a substantial effect on variation in obesity phenotypes in this particular US Caucasian population.
15905464 UCP2 functions as a physiologic regulator of ROS generation in endothelial cells.
15833942 reduction of free fatty acids(FFAs) induced by bilio-pancreatic diversion acts in inhibiting FFA transportation to the mitochondria uncoupling protein 2 (UCP-2), contributing to the decreased lipid oxidation inside the adipose tissue
15827742 UCP-2 can modify atherosclerotic processes inhuman vascular muscle smooth cells in response to high glucose and Angiotensin II.
15634780 The present results expose the critical importance of UCP2 in normal nigral dopamine cell metabolism.
15604415 Observational study of gene-disease association. (HuGE Navigator)
15604415 Our results suggest a role of UCP2 in atherogenesis
15564896 Observational study of gene-disease association. (HuGE Navigator)
15564896 The hypothesis that differences in the UCP-2 genes influence the susceptibility to anorexia nervossa was not supported.
15562023 Observational study of gene-disease association. (HuGE Navigator)
15562023 Single nucleotid polymorphism is associated with type 2 diabetes risk in Italy.
15527803 anion channel structure of UCP2 protein is oligomeric and the second transmembrane domain is essential for the voltage-dependence of this anion channel
15520825 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15475368 UCP2 has a role in hydroperoxy fatty acid cycling
15448008 UCP2 may be part of a novel adaptive response by which oxidative stress is modulated in colon cancer
15308133 Observational study of gene-disease association. (HuGE Navigator)
15220218 Observational study of gene-disease association. (HuGE Navigator)
15220218 The -866A/A genotype was associated with diabetes in women, but not in men. The -866A/A genotype of the UCP2 gene may contribute to diabetes susceptibility by affecting insulin sensitivity.
15192823 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15165610 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15149891 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
15120704 No association between the different polymorphisms and diabetic nephropathy.
15106800 Observational study of gene-disease association. (HuGE Navigator)
15106800 Polymorphism of uncoupling protein 2 gene is associated with hypertension, and suggests the possibility of uncoupling protein 2 gene as a target molecule for studies on the etiology and treatment of hypertension.
15061987 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15045692 Observational study of gene-disease association. (HuGE Navigator)
15039126 Observational study of gene-disease association. (HuGE Navigator)
15016641 Mitochondrial UCP2 in circulating monocytes may prevent excessive accumulation of monocytes/macrophages in the arterial wall, thereby reducing atherosclerotic plaque formation.
14974928 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14759071 Observational study of gene-disease association. (HuGE Navigator)
14759071 UCP2 allelic variants may not have a direct role in the pathogenesis and development of obesity.
14747301 UCP2 promoter polymorphism -866G/A does not affect obesity in Japanese type 2 diabetic patients but affects its transcription in beta-cells.
14730379 In type 2 diabetes there is a significant gene to gene interaction between the Ala55Val polymorphism in the uncoupling protein 2 gene ( UCP2) and the 161C>T polymorphism in the exon 6 of ppargamma.
14693721 Observational study of gene-disease association. (HuGE Navigator)
14693721 Juvenile obese subjects who are homozygous for the A variant have an increased ratio (3.6 +/- 1.2) of calories derived from carbohydrates to those from lipids.
14659466 Uncoupling protein 2 has a role in neuroprotection [review]
14627764 Observational study of gene-disease association. (HuGE Navigator)
14627764 variation of the uncoupling protein 2 promoter is not associated with obesity or obesity-related intermediary phenotypes in Danish subjects
12960023 Mitochondrial UCPs precondition neurons by dissociating cellular energy production from that of free radicals to withstand the harmful effects of cellular stress occurring in a variety of neurodegenerative disorders, including epilepsy.
12915397 Observational study of gene-disease association. (HuGE Navigator)
12915397 Uncoupling protein-2 variants show significant effects on insulin secretion in interaction with family-specific factors. However, the associated allele and the effects on gene expression are opposite to those reported previously.
12858170 Data suggest that uncoupling protein-2 is an inducible protein that is neuroprotective by activating cellular redox signaling or by inducing mild mitochondrial uncoupling that prevents the release of apoptogenic proteins.
12855674 Overexpression of human UCP2 attenuates reactive oxygen species generation and prevents mitochondrial Ca2+ overload in cultured neonatal rat cardiomyocytes revealing a novel mechanism of cardioprotection
12797456 Observational study of gene-disease association. (HuGE Navigator)
12797456 These data are the first to suggest that polymorphisms in the UCP2 gene may be genetic risk factors of spina bifida.
12787871 the recent advancements on the role of UCP2 in the brain and portray this uncoupler as an important player in normal neuronal function as well as a key cell death-suppressing device.
12746756 Observational study of gene-disease association. (HuGE Navigator)
12746756 No evidence for involvement of the promoter polymorphism -866 G/A of the UCP2 gene in childhood-onset obesity in humans
12734183 study of isolation, refolding, transport properties, and regulation of recombinant UCP2
12720538 UCPs in adipose tissue may play a role in the reduction in 24-h energy expenditure observed in post-obese individuals.
12716765 Observational study of gene-disease association. (HuGE Navigator)
12716765 the common -866G/A polymorphism in the UCP2 gene may contribute to the biological variation of insulin secretion
12690079 Observational study of gene-disease association. (HuGE Navigator)
12690079 there is a unique, near-uniform distribution of the uncoupling protein 2 insertion/deletion polymorphism in Tonga which may be relevant to the prevalence of obesity and type 2 diabetes
12670931 purine nucleotides must be the physiological inhibitors of UCP2-mediated uncoupling in vivo.
12401727 Observational study of gene-disease association. (HuGE Navigator)
12401727 A functional polymorphism in the promoter enhances obesity risk but reduces type 2 diabetes risk in obese middle-aged humans
12395215 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12385772 Observational study of gene-disease association. (HuGE Navigator)
12145158 Decreased mitochondrial proton leak and reduced expression in skeletal muscle of obese diet-resistant women
12075579 Observational study of gene-disease association. (HuGE Navigator)
12030845 hypothesis that recombinant human uncoupling protein-2 (UCP2) ectopically expressed in bacterial inclusion bodies binds nucleotides in a manner identical with the nucleotide-inhibited uncoupling that is observed in kidney mitochondria
11935148 evidence for its function as a metabolic regulator (REVIEW)
11920154 microsatellite markers at the UCP2/UCP3 locus on chromosome 11q13 in anorexia nervosa
11904148 Glucose induces and leptin decreases expression of uncoupling protein-2 mRNA in human islets.
11466580 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11381268 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence 

MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVRATASAQYRGVMGTILTMV      1 - 70
RTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRLLAGSTTGALAVAVAQPTDVV     71 - 140
KVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANLM    141 - 210
TDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRL    211 - 280
GSWNVVMFVTYEQLKRALMAACTSREAPF                                             281 - 309
//

Text Mined References (289)

PMID Year Title
26642043 2015 Defective Expression of the Mitochondrial-tRNA Modifying Enzyme GTPBP3 Triggers AMPK-Mediated Adaptive Responses Involving Complex I Assembly Factors, Uncoupling Protein 2, and the Mitochondrial Pyruvate Carrier.
26526553 2015 Interactions between uncoupling protein 2 gene polymorphisms, obesity and alcohol intake on liver function: a large meta-analysed population-based study.
26450681 2015 Regulatory role of estrogen-induced reactive oxygen species in the modulatory function of UCP 2 in papillary thyroid cancer cells.
26402942 2015 [The study of the association of polymorphism rs659366 gene UCP2 c obesity and type 2 diabetes among residents of the Moscow Region].
26356408 2015 Effects of Mitochondrial Uncoupling Protein 2 Inhibition by Genipin in Human Cumulus Cells.
26275882 2015 UCP2 modulates single-channel properties of a MCU-dependent Ca(2+) inward current in mitochondria.
26218518 2015 Polymorphisms of the UCP2 Gene Are Associated with Glomerular Filtration Rate in Type 2 Diabetic Patients and with Decreased UCP2 Gene Expression in Human Kidney.
26181366 2015 Uncoupling protein 2 mediates resistance to gemcitabine-induced apoptosis in hepatocellular carcinoma cell lines.
26107945 2015 MiR-133a Is Functionally Involved in Doxorubicin-Resistance in Breast Cancer Cells MCF-7 via Its Regulation of the Expression of Uncoupling Protein 2.
26082030 2015 Anion Transport or Nucleotide Binding by Ucp2 Is Indispensable for Ucp2-Mediated Efferocytosis.
25976474 2015 Mitochondrial uncoupling protein (UCP2) gene expression is regulated by miR-2909.
25960046 2015 UCP2 inhibition sensitizes breast cancer cells to therapeutic agents by increasing oxidative stress.
25910810 2015 Increased activity of mitochondrial uncoupling protein 2 improves stress resistance in cultured endothelial cells exposed in vitro to high glucose levels.
25789405 2015 Role of positively charged residues of the second transmembrane domain in the ion transport activity and conformation of human uncoupling protein-2.
25773007 2015 The influence of ethnicity in the association of WC, WHR, hypertension and PGC-1? (Gly482Ser), UCP2 -866 G/A and SIRT1 -1400 T/C polymorphisms with T2D in the population of Punjab.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25512910 2014 Uncoupling protein 2 regulates palmitic acid-induced hepatoma cell autophagy.
25482405 2015 Uncoupling protein-2 attenuates palmitoleate protection against the cytotoxic production of mitochondrial reactive oxygen species in INS-1E insulinoma cells.
25431415 2014 Uncoupling protein 2 gene (UCP2) 45-bp I/D polymorphism is associated with adiposity among Malaysian women.
25416956 2014 A proteome-scale map of the human interactome network.
25407516 2014 N-3 polyunsaturated fatty acids decrease levels of doxorubicin-induced reactive oxygen species in cardiomyocytes -- involvement of uncoupling protein UCP2.
25396419 2014 Investigation of variants in UCP2 in Chinese type 2 diabetes and diabetic retinopathy.
25351290 2015 The UCP2 -866 G>A promoter region polymorphism is associated with nonalcoholic steatohepatitis.
25140781 2014 [Effect of UCP2-siRNA on inflammatory response of cardiomyocytes induced by septic serum].
25081806 Effects of energy expenditure gene polymorphisms on obesity-related traits in obese children.
24965893 2014 The neuroprotective effect of human uncoupling protein 2 (hUCP2) requires cAMP-dependent protein kinase in a toxin model of Parkinson's disease.
24853548 2014 Mitochondrial retrograde signaling mediated by UCP2 inhibits cancer cell proliferation and tumorigenesis.
24804925 2014 Meta-analysis reveals the association of common variants in the uncoupling protein (UCP) 1-3 genes with body mass index variability.
24752406 2014 Association of the UCP polymorphisms with susceptibility to obesity: case-control study and meta-analysis.
24741957 2013 [Identification of genetic polymorphisms associated with overweight in athletes of winter sports].
24659521 2014 Impact of UCP2 polymorphism on long-term exercise-mediated changes in adipocytokines and markers of metabolic syndrome.
24642125 2014 The RNA binding protein hnRNP-K mediates post-transcriptional regulation of uncoupling protein-2 by angiopoietin-1.
24564667 2014 Antioxidant and regulatory role of mitochondrial uncoupling protein UCP2 in pancreatic beta-cells.
24440978 2013 Mitochondrial uncoupling protein 2 is up-regulated in human head and neck, skin, pancreatic, and prostate tumors.
24395786 2014 UCP2 transports C4 metabolites out of mitochondria, regulating glucose and glutamine oxidation.
24304655 2014 Transgenic overexpression of uncoupling protein 2 attenuates salt-induced vascular dysfunction by inhibition of oxidative stress.
24251413 2014 Does uncoupling protein 2 expression qualify as marker of disease status in LRRK2-associated Parkinson's disease?
24142693 2013 The growth factor receptor ERBB2 regulates mitochondrial activity on a signaling time scale.
24141050 2013 UCP2 overexpression worsens mitochondrial dysfunction and accelerates disease progression in a mouse model of amyotrophic lateral sclerosis.
24065674 2013 Lack of association of functional UCP2 -866G/A and Ala55Val polymorphisms and type 2 diabetes in the Chinese population based on a case-control study and a meta-analysis.
24041971 2014 Uncoupling protein 2 deficiency aggravates astrocytic endoplasmic reticulum stress and nod-like receptor protein 3 inflammasome activation.
23988448 2013 MicroRNA-133a-1 regulates inflammasome activation through uncoupling protein-2.
23835672 Alteration of UCP2 and ZO-1 expression in trabecular meshwork of neovascular glaucoma patients.
23639961 2013 Uncoupling protein 2 -866G/A and uncoupling protein 3 -55C/T polymorphisms in young South African Indian coronary artery disease patients.
23621569 2013 Effects of uncoupling protein 2 -866G/A polymorphism on platelet reactivity and prognosis in Chinese patients with type 2 diabetes and ischemic stroke.
23560041 2013 UCP2 -866G/A, Ala55Val and UCP3 -55C/T polymorphisms in association with obesity susceptibility - a meta-analysis study.
23537071 2013 Association between UCP2 A55V polymorphism and risk of cardiovascular events in patients with multi-vessel coronary arterial disease.
23521650 2013 Polymorphisms in uncoupling protein genes UCP2 and UCP3 are not associated with HIV-associated sensory neuropathy in African individuals.
23505621 2013 Genetic variants of uncoupling proteins-2 and -3 in relation to maximal oxygen uptake in different sports.
23434936 2013 UCP2 regulates the glucagon response to fasting and starvation.
23432701 2013 Uncoupling protein-2 gene polymorphisms are associated with obesity in Hungarian children.
23412863 2013 The role of uncoupling protein 2 and 3 genes polymorphism and energy expenditure in obese Indonesian children.
23365654 2013 Associations between UCP1 -3826A/G, UCP2 -866G/A, Ala55Val and Ins/Del, and UCP3 -55C/T polymorphisms and susceptibility to type 2 diabetes mellitus: case-control study and meta-analysis.
23314523 2013 Mitochondrial uncoupling protein 2 (UCP2) gene polymorphisms are associated with childhood obesity and related metabolic disorders.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23147265 2013 An association between -866G/A polymorphism in the promoter of UCP2 and obesity: a meta-analysis.
23101559 2013 UCP2 I/D modulated change in BMI during a lifestyle modification intervention study in Japanese subjects.
23088859 2012 Localisation and characterisation of uncoupling protein-2 (UCP2) in the human preterm placenta.
23088537 2013 Genipin-crosslinked cartilage-derived matrix as a scaffold for human adipose-derived stem cell chondrogenesis.
23069211 2013 Glutathionylation of UCP2 sensitizes drug resistant leukemia cells to chemotherapeutics.
23068098 2012 Guanosine diphosphate exerts a lower effect on superoxide release from mitochondrial matrix in the brains of uncoupling protein-2 knockout mice: new evidence for a putative novel function of uncoupling proteins as superoxide anion transporters.
23033381 2012 The UCP1 -3826A/G polymorphism is associated with diabetic retinopathy and increased UCP1 and MnSOD2 gene expression in human retina.
23008094 2013 Uncoupling protein 2 expression affects androgen synthesis in polycystic ovary syndrome.
22995745 2012 Genetic association of adipokine and UCP2 polymorphism with recurrent miscarriage among non-obese women.
22847181 2012 Mitochondrial uncoupling protein 2 regulates the effects of paclitaxel on Stat3 activation and cellular survival in lung cancer cells.
22807616 2012 Uncoupling protein 2 regulates glucagon-like peptide-1 secretion in L-cells.
22733179 2012 A 45-bp insertion/deletion polymorphism in uncoupling protein 2 is not associated with obesity in a Chinese population.
22634308 2012 Marked over expression of uncoupling protein-2 in beta cells exerts minor effects on mitochondrial metabolism.
22613561 2012 The uncoupling protein 2 -866G > a polymorphism is associated with the risk of ischemic stroke in Chinese type 2 diabetic patients.
22568573 2012 Uncoupling protein-2 45-base pair insertion/deletion polymorphism: is there an association with severe obesity and weight loss in morbidly obese subjects?
22533685 2012 Uncoupling protein 2 gene polymorphisms are associated with obesity.
22524567 2012 Toward understanding the mechanism of ion transport activity of neuronal uncoupling proteins UCP2, UCP4, and UCP5.
22490607 2012 Possible involvement of mitochondrial uncoupling protein-2 in cytotoxicity mediated by acquired N-methyl-D-aspartate receptor channels.
22349573 2013 The frequent UCP2 -866G>A polymorphism protects against insulin resistance and is associated with obesity: a study of obesity and related metabolic traits among 17?636 Danes.
22292025 2012 UCP2 inhibits ROS-mediated apoptosis in A549 under hypoxic conditions.
22266335 2012 A neuroprotective role of the human uncoupling protein 2 (hUCP2) in a Drosophila Parkinson's disease model.
22241057 2012 Variation in the uncoupling protein 2 and 3 genes and human performance.
22134120 2012 The presence of the -866A/55Val/Ins haplotype in the uncoupling protein 2 (UCP2) gene is associated with decreased UCP2 gene expression in human retina.
22085932 2011 UCP2 regulates energy metabolism and differentiation potential of human pluripotent stem cells.
22070905 2012 Genetic variants in nuclear-encoded mitochondrial proteins are associated with oxidative stress in obsessive compulsive disorders.
22001364 2011 Decreased mRNA expression of uncoupling protein 2, a mitochondrial proton transporter, in post-mortem prefrontal cortex from patients with bipolar disorder and schizophrenia.
21935467 2011 Cellular model of Warburg effect identifies tumor promoting function of UCP2 in breast cancer and its suppression by genipin.
21883184 2012 Polymorphisms of the UCP2 gene are associated with body fat distribution and risk of abdominal obesity in Spanish population.
21873561 2011 Telomere dysfunction-related serological markers are associated with type 2 diabetes.
21751002 2011 UCP2 -866G/A and Ala55Val, and UCP3 -55C/T polymorphisms in association with type 2 diabetes susceptibility: a meta-analysis study.
21720911 2011 ESR1, FTO, and UCP2 genes interact with bariatric surgery affecting weight loss and glycemic control in severely obese patients.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
21613221 2011 Leucine zipper EF hand-containing transmembrane protein 1 (Letm1) and uncoupling proteins 2 and 3 (UCP2/3) contribute to two distinct mitochondrial Ca2+ uptake pathways.
21584501 Association study between the -866G/A polymorphism in the promoter of uncoupling protein-2 gene and polycystic ovary syndrome.
21557918 2011 Abnormal expression of uncoupling protein-2 correlates with CYP11A1 expression in polycystic ovary syndrome.
21374988 2010 [Influence of genipin and vitamin E on UCP2 and other correlation factors in non-alcoholic fatty liver disease].
21340542 2012 A/ASP/VAL allele combination of IGF1R, IRS2, and UCP2 genes is associated with better metabolic profile, preserved energy expenditure parameters, and low mortality rate in longevity.
21266666 2011 Association between a 45-bp 3'untranslated insertion/deletion polymorphism in exon 8 of UCP2 gene and neural tube defects in a high-risk area of China.
21254885 2011 Gene polymorphisms and sport attitude in Italian athletes.
21175267 2011 Uncoupling protein 2 and 3 gene polymorphisms and their association with type 2 diabetes in asian indians.
21128330 2010 Mitochondrial uncoupling protein 2 expression in colon cancer and its clinical significance.
21074158 2011 Mitochondrial uncoupling protein gene cluster variation (UCP2-UCP3) and the risk of incident type 2 diabetes mellitus: the Women's Genome Health Study.
21029457 2010 Uncoupling protein 2 G(-866)A polymorphism: a new gene polymorphism associated with C-reactive protein in type 2 diabetic patients.
20937264 2011 Genetic variants in eleven telomere-associated genes and the risk of incident cardio/cerebrovascular disease: The Women's Genome Health Study.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20813684 2010 [Expression of uncoupling protein 2 on macrophages and its relation to interleukin-10/interferon ratio in patients with unexplained recurrent spontaneous abortion].
20804304 2010 Association study of the -866G/A UCP2 gene promoter polymorphism with type 2 diabetes and obesity in a Tehran population: a case control study.
20802238 2011 Population genetic analysis of the uncoupling proteins supports a role for UCP3 in human cold resistance.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20608355 2010 [Uncoupling protein 2 combats oxidative damage to human sperm].
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20595066 2010 Uncoupling protein-2 knockdown mediates the cytotoxic effects of cisplatin.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20427509 2010 Reduced expression of uncoupling protein 2 in adipose tissue in patients with hypothyroidism.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20384434 2010 Combining genetic markers and clinical risk factors improves the risk assessment of impaired glucose metabolism.
20359253 2010 Effect of the common -866G/A polymorphism of the uncoupling protein 2 gene on weight loss and body composition under sibutramine therapy in an obese Taiwanese population.
20332018 2010 Do UCP2 and mild uncoupling improve longevity?
20145583 2010 Interaction between the UCP2 -866 G>A polymorphism, diabetes, and beta-blocker use among patients with acute coronary syndromes.
20142250 2010 Diabetes genes and prostate cancer in the Atherosclerosis Risk in Communities study.
20056920 2010 Uncoupling protein-2 modulates myocardial excitation-contraction coupling.
19950601 2009 [Study on polymorphism of UCP2 gene in Chengdu simple obesity and normal-weight people and a preliminary investigation of its relationship with gut bacteria].
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19946892 2009 Nutritional and hormonal regulation of uncoupling protein 2.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19908126 2010 A common polymorphism in the promoter of UCP2 is associated with obesity and hyperinsulenemia in northern Indians.
19895332 2010 The association between gene polymorphisms in uncoupling proteins and hearing impairment in Japanese elderly.
19889414 2010 Association of telomere length with type 2 diabetes, oxidative stress and UCP2 gene variation.
19876004 2010 Obesity-related polymorphisms and their associations with the ability to regulate fat oxidation in obese Europeans: the NUGENOB study.
19846869 2009 Mitochondrial uncoupling protein 2 inhibits mast cell activation and reduces histamine content.
19833146 2010 Sex-specific effects of CNTF, IL6 and UCP2 polymorphisms on weight gain.
19769793 2009 Variation in the UCP2 and UCP3 genes associates with abdominal obesity and serum lipids: the Finnish Diabetes Prevention Study.
19760975 Prediction of successful weight reduction after laparoscopic adjustable gastric banding.
19753844 2009 [Association between polymorphism in uncoupling proteins and type 2 diabetes in a northwestern Colombian population].
19727213 2009 [An association study of abdominal obesity and polymorphisms of UCP2 and SREBP1c genes].
19681913 2010 Polymorphisms of the UCP2 gene are associated with proliferative diabetic retinopathy in patients with diabetes mellitus.
19680556 2009 Genetic variation in healthy oldest-old.
19659999 2009 Effects of UCP2 -866 G/A and ADRB3 Trp64Arg on rosiglitazone response in Chinese patients with Type 2 diabetes.
19653005 2009 The combined impact of metabolic gene polymorphisms on elite endurance athlete status and related phenotypes.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19556617 2009 A common UCP2 polymorphism predisposes to stress hyperglycaemia in severe sepsis.
19531977 2009 Association of common variants of UCP2 gene with low-grade inflammation in Swedish children and adolescents; the European Youth Heart Study.
19527523 2009 The common G-866A polymorphism of the UCP2 gene and survival in diabetic patients following myocardial infarction.
19491387 2009 Severe obesity is associated with novel single nucleotide polymorphisms of the ESR1 and PPARgamma locus in Han Chinese.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19413708 2009 The polymorphisms of UCP2 and UCP3 genes associated with fat metabolism, obesity and diabetes.
19387457 2009 Association of UCP2 -866 G/A polymorphism with chronic inflammatory diseases.
19368944 2009 Uncoupling protein 2 Ala55Val polymorphism is associated with a higher acute insulin response to glucose.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19155787 2009 Association of UCP2 and UCP3 polymorphisms with heart rate variability in Japanese men.
19140314 [Polymorphism of glucose intolerance and insulin resistance susceptibility genes in oncological patients].
19137581 2009 Uncoupling protein 2 polymorphisms as risk factors for NTDs.
19065272 2008 Mutations in UCP2 in congenital hyperinsulinism reveal a role for regulation of insulin secretion.
19056576 2009 Effects of novel capsinoid treatment on fatness and energy metabolism in humans: possible pharmacogenetic implications.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19039313 2009 Effects of UCP2 and UCP3 variants on the manifestation of overweight in Korean children.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18956255 Human uncoupling protein 2 and 3 genes are associated with obesity in Japanese.
18940651 2008 Is UCP2 gene polymorphism associated with decreased resting energy expenditure in nondialyzed chronic kidney disease patients?
18924534 2003 Single nucleotide polymorphism and lifestyle-related diseases in the Asia-Pacific region: comparative study in Okinawa, Palau and Thailand.
18846338 2008 Effect of target-directed regulation of uncoupling protein-2 gene expression on ischemia-reperfusion injury of hepatocytes.
18839467 2008 Role for mitochondrial uncoupling protein-2 (UCP2) in hyperhomocysteinemia and venous thrombosis risk?
18755175 2008 Associations between polymorphisms in the mitochondrial uncoupling proteins (UCPs) with T2DM.
18720901 2008 Genetic profiling of genes from the oxidative stress pathway among North and South Indians.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18593920 2008 The warburg effect in leukemia-stroma cocultures is mediated by mitochondrial uncoupling associated with uncoupling protein 2 activation.
18496642 2008 Lack of association between uncoupling protein-2 Ala55Val polymorphism and incident diabetes in the atherosclerosis risk in communities study.
18460338 2008 Association of the ins/del polymorphisms of uncoupling protein 2 (UCP2) with BMI in a Korean population.
18426866 2008 Association of FTO with obesity-related traits in the Cebu Longitudinal Health and Nutrition Survey (CLHNS) Cohort.
18413749 2008 The mitochondrial uncoupling protein-2 promotes chemoresistance in cancer cells.
18305572 2008 Expression of uncoupling proteins in human skin and skin-derived cells.
18301432 2008 Overexpression of UCP2 protects thalamic neurons following global ischemia in the mouse.
18301352 2008 The UCP2-866 A/A genotype is associated with low density lipoprotein particle sizes in the general population.
18242170 2008 Genetic risk factors for renal failure among north Indian ESRD patients.
18223008 2008 Genetic variants in the UCP2-UCP3 gene cluster and risk of diabetes in the Women's Health Initiative Observational Study.
18192542 2008 The common -866G>A variant in the promoter of UCP2 is associated with decreased risk of coronary artery disease in type 2 diabetic men.
18167556 2008 UCP-2 and UCP-3 proteins are differentially regulated in pancreatic beta-cells.
18059082 2008 Association of ADRB1 and UCP3 gene polymorphisms with insulin sensitivity but not obesity.
18031357 2007 Effects of genetic polymorphism of uncoupling protein 2 on body fat and calorie restriction-induced changes.
18018477 2007 Amplified expression of uncoupling proteins in human brain ischemic lesions.
18006489 2008 Mitochondrial uncoupling protein 2 mediates temperature heterogeneity in atherosclerotic plaques.
17985659 2007 The common -866G/A polymorphism of the UCP2 gene in healthy Iranians compared with world populations.
17894153 2007 Ala55Val polymorphism on UCP2 gene predicts greater weight loss in morbidly obese patients undergoing gastric banding.
17870627 2007 Association between obesity and insulin resistance with UCP2-UCP3 gene variants in Spanish children and adolescents.
17718790 2007 Association of n-6 long-chain polyunsaturated fatty acids to -866 G/A genotypes of the human uncoupling protein 2 gene in obese children.
17701054 2007 Interaction between the UCP2-866G/A, mtDNA 10398G/A and PGC1alpha p.Thr394Thr and p.Gly482Ser polymorphisms in type 2 diabetes susceptibility in North Indian population.
17666355 2007 [Uncoupling protein-2 expression in granular cells and embryo development in in vitro fertilization-embryo transfer cycle].
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17570749 2005 Genetic prediction of future type 2 diabetes.
17555951 2008 Interaction between the uncoupling protein 2 -866G>A gene variant and cigarette smoking to increase oxidative stress in subjects with diabetes.
17544366 2007 Effects of genetic polymorphisms of UCP2 and UCP3 on very low calorie diet-induced body fat reduction in Korean female subjects.
17512314 2007 Association of UCP2 and UCP3 gene polymorphisms with serum high-density lipoprotein cholesterol among Korean women.
17502873 2007 UCP2 A55V variant is associated with obesity and related phenotypes in an aboriginal community in Taiwan.
17463068 2007 UCP2 and mitochondrial haplogroups as a multiple sclerosis risk factor.
17462780 2007 The modulating effects of the overexpression of uncoupling protein 2 on the formation of reactive oxygen species in vascular cells.
17397545 2007 The uncoupling protein 1 gene, UCP1, is expressed in mammalian islet cells and associated with acute insulin response to glucose in African American families from the IRAS Family Study.
17351641 2007 Uncoupling proteins 2 and 3 are fundamental for mitochondrial Ca2+ uniport.
17342078 2007 Plasma leptin levels are related to body composition, sex, insulin levels and the A55V polymorphism of the UCP2 gene.
17316620 2007 Mitochondrial uncoupling protein 2 gene transcript levels are elevated in maturating erythroid cells.
17242157 2007 Polyunsaturated fatty acids activate human uncoupling proteins 1 and 2 in planar lipid bilayers.
17240372 2007 UCP2 is a mitochondrial transporter with an unusual very short half-life.
17170091 2006 Impact of uncoupling protein-2 overexpression on proinsulin processing.
17130180 2007 Candidate gene genotypes, along with conventional risk factor assessment, improve estimation of coronary heart disease risk in healthy UK men.
17066476 2007 Synergistic association of mitochondrial uncoupling protein (UCP) genes with schizophrenia.
17052689 2006 Effects of rosiglitazone on global ischemia-induced hippocampal injury and expression of mitochondrial uncoupling protein 2.
16982633 2007 Changes in fat mass after initiation of maintenance dialysis is influenced by the uncoupling protein 2 exon 8 insertion/deletion polymorphism.
16845607 2006 Translation control of UCP2 synthesis by the upstream open reading frame.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16741267 2006 Uncoupling protein 2 promoter polymorphism -866G/A, central adiposity, and metabolic syndrome in Asians.
16644712 2006 Variation in the UCP2-UCP3 gene cluster predicts the development of type 2 diabetes in healthy middle-aged men.
16622580 Leptin resistance conferred by a combination of single nucleotide polymorphism and the adoption of a Western lifestyle in urban areas of Thailand.
16567833 2006 Uncoupling protein 2 promoter polymorphism -866G/A affects peripheral nerve dysfunction in Japanese type 2 diabetic patients.
16562813 [Influence of the -866G/A polymorphism of the UCP2 gene on an obese pediatric population].
16373902 2006 Functional polymorphisms of UCP2 and UCP3 are associated with a reduced prevalence of diabetic neuropathy in patients with type 1 diabetes.
16282353 2006 Role of peroxisome proliferator-activated receptor-gamma coactivator-1alpha in the transcriptional regulation of the human uncoupling protein 2 gene in INS-1E cells.
16167150 2005 Genetic variation in UCP2 (uncoupling protein-2) is associated with energy metabolism in Pima Indians.
16054055 2005 Targeted expression of the human uncoupling protein 2 (hUCP2) to adult neurons extends life span in the fly.
16021520 2005 Association of a common polymorphism in the promoter of UCP2 with susceptibility to multiple sclerosis.
15985484 2005 Impact of common polymorphisms in candidate genes for insulin resistance and obesity on weight loss of morbidly obese subjects after laparoscopic adjustable gastric banding and hypocaloric diet.
15959859 2005 Single nucleotide variants in the beta2-adrenergic and beta3-adrenergic receptor genes explained 18.3% of adolescent obesity variation.
15951317 2005 The uncoupling protein 2 Ala55Val polymorphism is associated with diabetes mellitus: the CARDIA study.
15910756 2005 Linkage exclusion analysis of two candidate regions on chromosomes 7 and 11: leptin and UCP2/UCP3 are not QTLs for obesity in US Caucasians.
15905464 2005 Effects of recombinant adenovirus-mediated uncoupling protein 2 overexpression on endothelial function and apoptosis.
15833942 2005 Changes in fat mass influence SREBP-1c and UCP-2 gene expression in formerly obese subjects.
15827742 2005 The effects of the overexpression of recombinant uncoupling protein 2 on proliferation, migration and plasminogen activator inhibitor 1 expression in human vascular smooth muscle cells.
15634780 2005 Uncoupling protein-2 is critical for nigral dopamine cell survival in a mouse model of Parkinson's disease.
15604415 2005 Associations of the UCP2 gene locus with asymptomatic carotid atherosclerosis in middle-aged women.
15564896 2004 Uncoupling protein-2/uncoupling protein-3 gene polymorphism is not associated with anorexia nervosa.
15562023 2005 The common -866G/A polymorphism in the promoter region of the UCP-2 gene is associated with reduced risk of type 2 diabetes in Caucasians from Italy.
15527803 2004 Second transmembrane domain of human uncoupling protein 2 is essential for its anion channel formation.
15520825 2005 Interactions between physical activity and variants of the genes encoding uncoupling proteins -2 and -3 in relation to body weight changes during a 10-y follow-up.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475368 2004 Hydroperoxy fatty acid cycling mediated by mitochondrial uncoupling protein UCP2.
15448008 2004 Expression of uncoupling protein-2 in human colon cancer.
15308133 2004 A polymorphism in the promoter of UCP2 gene modulates lipid levels in patients with type 2 diabetes.
15220218 2004 The -866A/A genotype in the promoter of the human uncoupling protein 2 gene is associated with insulin resistance and increased risk of type 2 diabetes.
15192823 2004 [Additive effects of the variants in the beta(3)-adrenergic receptor and uncoupling protein-2 genes on obesity in Chinese].
15165610 2004 Higher obesity risk associated with the exon-8 insertion of the UCP2 gene in a Spanish case-control study.
15149891 2004 Simple and rapid detection of uncoupling protein-2 - 866G/A polymorphism by mutagenically separated polymerase chain reaction.
15120704 Putative role of polymorphisms in UCP1-3 genes for diabetic nephropathy.
15106800 2004 A common polymorphism of uncoupling protein 2 gene is associated with hypertension.
15061987 2004 [Common variants in beta 3-adrenergic-receptor and uncoupling protein-2 genes are associated with type 2 diabetes and obesity].
15045692 2004 Genetic variation in uncoupling protein 3 is associated with dietary intake and body composition in females.
15039126 2004 Cardiovascular risk in healthy men and markers of oxidative stress in diabetic men are associated with common variation in the gene for uncoupling protein 2.
15016641 2004 Overexpression of uncoupling protein 2 in THP1 monocytes inhibits beta2 integrin-mediated firm adhesion and transendothelial migration.
14974928 2003 Variants of uncoupling protein-2 gene and obesity: interaction with peroxisome proliferator-activated receptorgamma2.
14759071 2003 Lack of association between UCP2 gene polymorphisms and obesity phenotype in Italian Caucasians.
14747301 2004 Uncoupling protein 2 promoter polymorphism -866G/A affects its expression in beta-cells and modulates clinical profiles of Japanese type 2 diabetic patients.
14730379 2004 Multifactor-dimensionality reduction shows a two-locus interaction associated with Type 2 diabetes mellitus.
14693721 2004 The common -866 G/A polymorphism in the promoter of uncoupling protein 2 is associated with increased carbohydrate and decreased lipid oxidation in juvenile obesity.
14659466 2003 Uncoupling protein 2: a novel player in neuroprotection.
14627764 2003 Mutational analysis of the UCP2 core promoter and relationships of variants with obesity.
12960023 2003 Uncoupling protein 2 prevents neuronal death including that occurring during seizures: a mechanism for preconditioning.
12915397 2004 Uncoupling protein-2 polymorphisms in type 2 diabetes, obesity, and insulin secretion.
12912909 2003 A signalling role for 4-hydroxy-2-nonenal in regulation of mitochondrial uncoupling.
12858170 2003 Uncoupling protein-2 prevents neuronal death and diminishes brain dysfunction after stroke and brain trauma.
12855674 2003 Uncoupling protein-2 overexpression inhibits mitochondrial death pathway in cardiomyocytes.
12797456 2003 Risk factors for neural tube defects: associations between uncoupling protein 2 polymorphisms and spina bifida.
12787871 2003 Mitochondrial uncoupling protein 2 in the central nervous system: neuromodulator and neuroprotector.
12746756 2003 No evidence for involvement of the promoter polymorphism -866 G/A of the UCP2 gene in childhood-onset obesity in humans.
12734183 2003 Reconstitution of recombinant uncoupling proteins: UCP1, -2, and -3 have similar affinities for ATP and are unaffected by coenzyme Q10.
12720538 2003 Reduced expression of uncoupling proteins-2 and -3 in adipose tissue in post-obese patients submitted to biliopancreatic diversion.
12716765 2003 A common polymorphism in the promoter of UCP2 contributes to the variation in insulin secretion in glucose-tolerant subjects.
12690079 2003 A 45-bp insertion/deletion polymorphism of uncoupling protein 2 in relation to obesity in Tongans.
12670931 2003 Activating omega-6 polyunsaturated fatty acids and inhibitory purine nucleotides are high affinity ligands for novel mitochondrial uncoupling proteins UCP2 and UCP3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401727 2002 A functional polymorphism in the promoter of UCP2 enhances obesity risk but reduces type 2 diabetes risk in obese middle-aged humans.
12395215 2002 Polymorphisms in candidate obesity genes and their interaction with dietary intake of n-6 polyunsaturated fatty acids affect obesity risk in a sub-sample of the EPIC-Heidelberg cohort.
12385772 2002 Lack of association between the uncoupling protein-2 Ala55Val gene polymorphism and phenotypic features of the Metabolic Syndrome.
12355400 2002 Genomewide linkage analysis of body mass index across 28 years of the Framingham Heart Study.
12145158 2002 Decreased mitochondrial proton leak and reduced expression of uncoupling protein 3 in skeletal muscle of obese diet-resistant women.
12075579 2002 Genetic factors as predictors of weight gain in young adult Dutch men and women.
12030845 2002 Nucleotide binding to human uncoupling protein-2 refolded from bacterial inclusion bodies.
11994670 2002 The uncoupling proteins.
11920154 2002 Analysis of microsatellite markers at the UCP2/UCP3 locus on chromosome 11q13 in anorexia nervosa.
11780125 2002 Superoxide activates mitochondrial uncoupling proteins.
11713718 2002 Quantitative-trait loci influencing body-mass index reside on chromosomes 7 and 13: the National Heart, Lung, and Blood Institute Family Heart Study.
11466580 2001 Association between polymorphisms in candidate genes and morbid obesity.
11381268 2001 A common polymorphism in the promoter of UCP2 is associated with decreased risk of obesity in middle-aged humans.
10785390 2000 Uncoupling proteins 2 and 3 interact with members of the 14.3.3 family.
10772343 2000 Specific sequence of motifs of mitochondrial uncoupling proteins.
10620491 2000 The uncoupling protein homologues: UCP1, UCP2, UCP3, StUCP and AtUCP.
10082652 1999 Functional organization of the human uncoupling protein-2 gene, and juxtaposition to the uncoupling protein-3 gene.
10027754 1999 Structural organization and mutational analysis of the human uncoupling protein-2 (hUCP2) gene.
9568704 1998 Structure and organization of the human uncoupling protein 2 gene and identification of a common biallelic variant in Caucasian and African-American subjects.
9559644 1998 High expression of uncoupling protein 2 in foetal liver.
9196039 1997 UCP3: an uncoupling protein homologue expressed preferentially and abundantly in skeletal muscle and brown adipose tissue.
9180264 1997 Uncoupling protein-3: a new member of the mitochondrial carrier family with tissue-specific expression.
9133562 1997 Cloning and characterization of an uncoupling protein homolog: a potential molecular mediator of human thermogenesis.
9054939 1997 Uncoupling protein-2: a novel gene linked to obesity and hyperinsulinemia.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.