Property Summary

NCBI Gene PubMed Count 27
PubMed Score 70.55
PubTator Score 221.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Inflammation 109
Lung diseases 48
Disease Target Count Z-score Confidence
chronic kidney disease 90 3.503 1.8

Synonym

Accession Q969E3 Q496H2 Q5SR91
Symbols SCP
SPC
UCNIII

Gene

PDB

2RMH   3N93  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (19)

PMID Text
26350463 results show that activation of CRH receptors by CRH ligands stimulates VEGF-A expression in intestinal epithelial cells through the cAMP/CREB pathway
26076035 The paracrine actions of Ucn3 activate a negative feedback loop that promotes somatostatin release to ensure the timely reduction of insulin secretion upon normalization of plasma glucose.
25304878 The molecular modifications of urocortin 3[36-38] led to an improved understanding of the relationship between molecular structure and biological activity of this peptide, could be further tested for possible clinical treatment of depression
25148370 Data suggest that UCN3 expression can serve as a late stage maturation/differentiation marker in beta-cells during pancreogenesis. [REVIEW]
23349753 SCP inhibits a subpopulation of PVN neurons, especially OTergic magnocellular neurons, by enhancing the activity of GIRK channels via CRF-R2
22000474 study showed that Ucn2 and Ucn3 differentially regulate the LPS-induced TNF-alpha and IL-10 expression and secretion in trophoblast explants acting through CRH-R2. Ucn3 has an anti-inflammatory effect.
21454316 These data suggest a possible involvement of urocortin 2 and Ucn 3 in the mechanisms of endometriosis.
21360527 Confirm the anti-inflammatory function of VIP, through the modulation of the expression of CRF system that impacts in a reduction of mediators with inflammatory/destructive functions.
20616367 Placental Ucn2 and Ucn3 expression is sensitive to O(2) tensions and mediated by HIF-1alpha. In preeclampsia, the increased expression of both peptides may reflect a response to the oxidative stress.
20368512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19351656 the SCP/CRHR2 system is present in human ovaries and treatment with SCP/Ucn3 inhibits progesterone production by cultured granulosa-lutein cells through interaction with CRHR2
18504423 Observational study of gene-disease association. (HuGE Navigator)
17074339 Both peptides were immunolocalized in epithelial, stromal, and endothelial cells.
16626608 UCN2 and UCN3 are expressed in human placenta, decidua, and fetal membranes and may be proposed as regulators of placental vascular endothelial tone.
16095756 Ucn3 is produced in the normal adrenal gland and in adrenal tumors (both adrenocortical tumors and pheochromocytomas) and acts as an autocrine or paracrine regulator in both the normal and cancerous adrenal gland tissue.
15949638 Ucn 3 plays some physiological or pathological roles in the modulation of gastrointestinal functions during stressful conditions.
15070962 Expression of Ucn III/SCP in the human heart and kidney as well as brain and pituitary tissues and its presence in plasma and urine. Ucn III/SCP may therefore regulate the cardiac and renal function as a local factor and a circulating hormone.
14764822 CRH-R1:CRH-R2 ratio varied according to fat-depot type; whereas CRH-R1 expression was higher in sc fat than in visceral fat, the opposite was true for CRH-R2.
14519439 SCP and UCN are potent activators of the p42/44 MAPK pathway, with SRP able to induce phosphorylation of p42/44 MAPK as well, albeit not as pronounced

AA Sequence

MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSG      1 - 70
EEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKA     71 - 140
KNLRAQAAANAHLMAQIGRKK                                                     141 - 161
//

Text Mined References (30)

PMID Year Title
26350463 2015 Corticotropin Releasing Hormone and Urocortin 3 Stimulate Vascular Endothelial Growth Factor Expression through the cAMP/CREB Pathway.
26076035 2015 Urocortin3 mediates somatostatin-dependent negative feedback control of insulin secretion.
25304878 2014 Short analogs and mimetics of human urocortin 3 display antidepressant effects in vivo.
25148370 2014 Maturation of stem cell-derived beta-cells guided by the expression of urocortin 3.
23349753 2013 Effects of stresscopin on rat hypothalamic paraventricular nucleus neurons in vitro.
22449649 2012 Genome-wide association study of intelligence: additive effects of novel brain expressed genes.
22000474 2011 Effects of urocortin 2 and urocortin 3 on IL-10 and TNF-? expression and secretion from human trophoblast explants.
21454316 2011 Urocortin 2 and urocortin 3 in endometriosis: evidence for a possible role in inflammatory response.
21360527 2011 Mapping the CRF-urocortins system in human osteoarthritic and rheumatoid synovial fibroblasts: effect of vasoactive intestinal peptide.
20966082 2010 Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor.
20616367 2010 Hypoxia and preeclampsia: increased expression of urocortin 2 and urocortin 3.
20368512 2010 Association of polymorphisms in genes regulating the corticotropin-releasing factor system with antidepressant treatment response.
19351656 2009 Suppression of progesterone production by stresscopin/urocortin 3 in cultured human granulosa-lutein cells.
18504423 2008 Polymorphisms in inflammation-related genes are associated with susceptibility to major depression and antidepressant response.
18052377 2007 Common and divergent structural features of a series of corticotropin releasing factor-related peptides.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17074339 2006 Human endometrium expresses urocortin II and III messenger RNA and peptides.
16626608 2006 Urocortin 2 and urocortin 3 are expressed by the human placenta, deciduas, and fetal membranes.
16095756 2006 Expression of urocortin 3/stresscopin in human adrenal glands and adrenal tumors.
15949638 2005 Urocortin 3/stresscopin in human colon: possible modulators of gastrointestinal function during stressful conditions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476935 2004 Ancient evolution of stress-regulating peptides in vertebrates.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15070962 2004 Expression of urocortin III/stresscopin in human heart and kidney.
14764822 2004 Corticotropin-releasing hormone system in human adipose tissue.
14519439 2003 Protective effects of the urocortin homologues stresscopin (SCP) and stresscopin-related peptide (SRP) against hypoxia/reoxygenation injury in rat neonatal cardiomyocytes.
12615952 2003 International Union of Pharmacology. XXXVI. Current status of the nomenclature for receptors for corticotropin-releasing factor and their ligands.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11416224 2001 Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor.
11329063 2001 Human stresscopin and stresscopin-related peptide are selective ligands for the type 2 corticotropin-releasing hormone receptor.