Property Summary

NCBI Gene PubMed Count 31
PubMed Score 74.08
PubTator Score 221.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Inflammation 120 0.0 0.0
Lung diseases 50 0.0 0.0
Disease Target Count Z-score Confidence
chronic kidney disease 90 3.539 1.8

Expression

Gene RIF (23)

AA Sequence

MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFHYLRSRDASSG      1 - 70
EEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKFTLSLDVPTNIMNLLFNIAKA     71 - 140
KNLRAQAAANAHLMAQIGRKK                                                     141 - 161
//

Text Mined References (34)

PMID Year Title