Property Summary

NCBI Gene PubMed Count 75
PubMed Score 595.18
PubTator Score 280.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma -1.200 5.3e-06
atypical teratoid / rhabdoid tumor -1.500 6.7e-04
glioblastoma -1.400 2.6e-04
medulloblastoma, large-cell -1.800 6.0e-06
pediatric high grade glioma -1.200 3.8e-04
group 4 medulloblastoma -1.300 2.0e-03
pilocytic astrocytoma -1.200 6.4e-05

Gene RIF (50)

PMID Text
26138318 Findings identify Ucn as a potential mediator that inhibits TGFbeta1 oncogenic signaling in breast neoplasm.
25951715 In women with adnexal endometrioma versus teratoma, the medians were 105.31 pg/mL versus 120.84 pg/mL for urocortin, 7.16 pg/mL versus 9.13 pg/mL for leptin and 584.33 pg/mL versus 657.82 pg/mL for ghrelin (p > 0.05), respectively.
25462164 Ucn1 prevents the development of atherosclerosis by suppressing EC inflammatory response and proliferation, macrophage foam cell formation, and VSMC migration and proliferation
25339828 Production of CRF and UCN1 in human dendritic cells is strongly augmented by commensal intestinal bacteria.
25240771 These data suggest that UVB-stimulated Ucn1 contributes to TRP1 production via the transcription of both Nurr-1 and Nur77. Ucn1, produced in melanoma cells, acts on melanoma cells themselves in an autocrine manner.
25239507 UCN I is secreted from human glioblastoma cells by exocytosis through constitutive secretory granules.
25172671 down-regulated expression in the placenta and maternal serum during intrahepatic cholestasis of pregnancy may impair the blood flow regulation of the utero-placental-fetal unit and contribute to fetal distress
24954177 Cardioplegic arrest failed to induce cardiac myocyte overexpression of urocortin in diabetic hearts.
24290358 A detailed conformational model for the CRF1R-Ucn1 complex based on the many ligand-receptor interactions determined was here and eventually revealed unique features of peptide ligand binding to class B GPCRs.
24012814 all neonates expressed UCN1 in the Edinger-Westphal nucleus independent of the degree of neuropathological injury.
23987517 during the midluteal phase of the cycle, metformin may decrease the production of corticotropin-releasing hormone and UCN in the endometrium.
23846219 Ucn is both an essential chondrocyte survival signal peptide and a chondroprotective agent in the presence of pro-apoptotic stimuli.
23803006 Data suggest that low urocortin-1 concentration in midtrimester amniotic fluid is an early indicative marker of preterm birth.
23801677 Dihydrotestosterone decrease the expression of urocortin in human umbilical vein endothelial cells.
23531852 Urocortin expression inversely correlates with higher tumor grade and advanced tumor stage in gastric adenocarcinomas.
23416839 in human melanoma HMV-II cells both CRF and Ucn1 regulate TRP1 gene expression via Nurr-1/Nur77 production, independent of pro-opiomelanocortin or alpha-melanocyte-stimulating hormone stimulation.
22639902 Serum urocortin could not predict women who delivered preterm among women with signs of preterm labor.
21360527 Confirm the anti-inflammatory function of VIP, through the modulation of the expression of CRF system that impacts in a reduction of mediators with inflammatory/destructive functions.
21289256 Women with endometriosis show an impaired endometrial expression of CRH and Ucn mRNA.
20670842 Higher plasma levels of urocortin-1, but not urocortin-II, are associated with worse left ventricular diastolic performance in patients with chronic systolic heart failure.
20480172 not found to be efficient in distinguishing endometrioma from other benign ovarian cysts or to be superior to CA125 in the diagnosis of endometrioma
20468064 Observational study of gene-disease association. (HuGE Navigator)
20368512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20363214 This article provides a review of the role of urocortins in normal cardiovascular physiology and in the pathophysiology of heart failure.
19961889 Results demonstrate that plasma concentrations of UCN are significantly increased in patients with heart failure (HF). UCN may participate in the neurohumoral response of HF.
19949969 UCN is produced during the development of mesenchymal progenitor cells to osteoblasts and differentially regulated during culture as well as by differentiation factors.
19893766 Results suggest that urocortin concentrations in the amniotic fluid of genetic amniocentesis are not predictive of preterm labor and birth.
19808377 Plasma urocortin 1 is elevated in heart failure (in proportion to the degree of cardiac dysfunction) in concert with the generalized neurohormonal activation seen in this condition.
19703147 reverses LPS-induced TNF-alpha release from trophoblast
19619932 The low amniotic fluid concentrations of urocortin at mid-trimester may be a signal of predisposition to preterm delivery.
19437022 nuclear translocation of Ucn along with the loss of CRFR2 in epithelial cells and microvasculature of tumoral specimens may be involved in the pathobiology of renal cell carcinoma
19086053 Observational study of gene-disease association. (HuGE Navigator)
18670748 Ucn showed a significant role in the regulation of local inflammation, proliferation, and relaxation of smooth muscle tone in different organs through activation of corticotropin releasing factor receptor 2 (CRFR2).
18443956 UCN inhibited the proliferation and promoted the apoptosis of endothelial cells and down-regulated VEGF expression in vivo via CRFR2.
18329817 The Ucn1-mRNA level in non-preganglionic Edinger-Westphal nucleus neurons is about 9.12 times higher in male but unchanged in female suicide victims.
18234674 CRF-BP has distinct and separable binding surfaces for CRF and Ucn 1
17597629 In allergic nasal mucosa, increased expression levels of urocortin and its receptors may contribute to increased mucosal swelling and vascular permeability, playing an important role in the pathogenesis of allergic rhinitis.
17154253 NPY, via NPY Y5 and to a lesser extent via the Y1 receptors, exerts a stimulatory action on Ucn1 cells in the nonpreganglionic Edinger-Westphal nucleus.
16920724 The evidence that (i) UCN is highly expressed in the secretory phase of the endometrial cycle; (ii) cAMP & E(2) + MPA modulate secretion of UCN & (iii) UCN induces HESCs decidualization together suggest a possible role for UCN in endometrial physiology.
16698078 expression of UCN in extravillous trophoblast cells and the activation of the UCN gene promoter by the diacylglycerol/PKC pathway
16675846 CRH peptides can differentially influence hair follicle melanocyte behavior not only via CRH-R1 signaling but also by complex cross-talk between CRH-R1 and CRH-R2.
16340217 Urocortin potently suppressed the generation of angiotensin II-induced reactive oxygen species (ROS) in HUVECs. Tumor necrosis factor-alpha, interferon-gamma & pitavastatin increased the urocortin mRNA levels and its release from HUVECs.
15924674 Urocortin peptide and mRNA was significantly increased in women with preeclampsia.
15784504 urocortin may regulate uterine artery tone at mid gestation.
15072543 mRNA expression of urocortin was low during the last weeks of pregnancy in the placenta, myometrium and choriodecidua
14764822 Adipose tissue expressed urocortin and stresscopin, the predominant ligands of peripheral CRH-R2.
14576187 human cord blood-derived cultured mast cells (hCBMC) at 10 wk, but not at 2 wk, are immunocytochemically positive for CRH and UCN
14519439 SCP and UCN are potent activators of the p42/44 MAPK pathway, with SRP able to induce phosphorylation of p42/44 MAPK as well, albeit not as pronounced
12519893 a highly significant, but negative, correlation has been found between Ucn levels and gastric inflammation, suggesting that Ucn may exert an antiinflammatory effect in gastric mucosa
11836334 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGR      1 - 70
LGLGTAGERPRRDNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSVGK                     71 - 124
//

Text Mined References (78)

PMID Year Title
26138318 2015 Urocortin attenuates TGF?1-induced Snail1 and slug expressions: inhibitory role of Smad7 in Smad2/3 signaling in breast cancer cells.
25951715 2015 Novel markers in the diagnostics of endometriomas: Urocortin, ghrelin, and leptin or leukocytes, fibrinogen, and CA-125?
25541373 2015 Urocortin--from Parkinson's disease to the skeleton.
25462164 2014 Vasoprotective effects of urocortin 1 against atherosclerosis in vitro and in vivo.
25339828 2014 Production of corticotropin-releasing factor and urocortin from human monocyte-derived dendritic cells is stimulated by commensal bacteria in intestine.
25240771 2014 Ultraviolet B radiation-stimulated urocortin 1 is involved in tyrosinase-related protein 1 production in human melanoma HMV-II cells.
25239507 2015 Secretion of urocortin I by human glioblastoma cell lines, possibly via the constitutive pathway.
25172671 2014 Expression of urocortin and corticotrophin-releasing hormone receptor-2 in patients with intrahepatic cholestasis of pregnancy.
24954177 2014 Diabetic hearts have lower basal urocortin levels that fail to increase after cardioplegic arrest: association with increased apoptosis and postsurgical cardiac dysfunction.
24290358 2013 Genetically encoded chemical probes in cells reveal the binding path of urocortin-I to CRF class B GPCR.
24012814 2013 Immunohistochemical demonstration of urocortin 1 in Edinger-Westphal nucleus of the human neonate: colocalization with tyrosine hydroxylase under acute perinatal hypoxia.
23987517 2013 Metformin reduces the expression of corticotropin-releasing hormone and urocortin in the endometrium of healthy women.
23846219 2013 Urocortin protects chondrocytes from NO-induced apoptosis: a future therapy for osteoarthritis?
23803006 2013 Amniotic fluid urocortin-1 concentrations for the prediction of preterm delivery.
23801677 2013 Dihydrotestosterone alters urocortin levels in human umbilical vein endothelial cells.
23531852 2014 The association of urocortin expression with clinicopathologic parameters of gastric adenocarcinomas.
23416839 2013 Involvement of Nurr-1/Nur77 in corticotropin-releasing factor/urocortin1-induced tyrosinase-related protein 1 gene transcription in human melanoma HMV-II cells.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22639902 2013 Value of serum urocortin concentration in the prediction of preterm birth.
21360527 2011 Mapping the CRF-urocortins system in human osteoarthritic and rheumatoid synovial fibroblasts: effect of vasoactive intestinal peptide.
21289256 2011 Impaired CRH and urocortin expression and function in eutopic endometrium of women with endometriosis.
20966082 2010 Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor.
20670842 2010 Clinical significance of endogenous vasoactive neurohormones in chronic systolic heart failure.
20480172 2011 The value of urocortin and Ca-125 in the diagnosis of endometrioma.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20368512 2010 Association of polymorphisms in genes regulating the corticotropin-releasing factor system with antidepressant treatment response.
20363214 2010 Urocortins in heart failure.
19961889 2010 Circulating levels of stress associated peptide Urocortin in heart failure patients.
19949969 2009 Differentiation dependent expression of urocortin's mRNA and peptide in human osteoprogenitor cells: influence of BMP-2, TGF-beta-1 and dexamethasone.
19893766 2009 Urocortin in second trimester amniotic fluid: its role as predictor of preterm labor.
19808377 2009 Plasma urocortin 1 in human heart failure.
19703147 2009 Urocortin increases IL-4 and IL-10 secretion and reverses LPS-induced TNF-alpha release from human trophoblast primary cells.
19619932 2009 Amniotic fluid urocortin, CRF, oestriol, dehydroepiandrosterone sulfate and cortisol concentrations at mid-trimester: putative relationship with preterm delivery.
19437022 2009 Urocortin and corticotropin-releasing factor receptor 2 in human renal cell carcinoma: disruption of an endogenous inhibitor of angiogenesis and proliferation.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18670748 2008 [Expression of corticotropin releasing factor receptor 2 (CRFR2) in the human prostate. A new potential target for medical therapy of benign prostatic hyperplasia].
18443956 2008 Urocortin's inhibition of tumor growth and angiogenesis in hepatocellular carcinoma via corticotrophin-releasing factor receptor 2.
18329817 2008 Gender-related urocortin 1 and brain-derived neurotrophic factor expression in the adult human midbrain of suicide victims with major depression.
18234674 2008 Residues of corticotropin releasing factor-binding protein (CRF-BP) that selectively abrogate binding to CRF but not to urocortin 1.
18052377 2007 Common and divergent structural features of a series of corticotropin releasing factor-related peptides.
17597629 2007 Over-expression of neuropeptide urocortin and its receptors in human allergic nasal mucosa.
17154253 2007 Neuropeptide Y activates urocortin 1 neurons in the nonpreganglionic Edinger-Westphal nucleus.
16920724 2007 Secretory endometrium highly expresses urocortin messenger RNA and peptide: possible role in the decidualization process.
16698078 Expression of urocortin in the extravillous human trophoblast at the implantation site.
16675846 2006 Modulation of the human hair follicle pigmentary unit by corticotropin-releasing hormone and urocortin peptides.
16340217 2006 Endothelial urocortin has potent antioxidative properties and is upregulated by inflammatory cytokines and pitavastatin.
15924674 2005 [Study on the level of placental urocortin and corticotropin-releasing hormone receptor 2beta of preeclampsia].
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15784504 2005 Reduced maternal plasma urocortin concentrations and impaired uterine artery blood flow at human mid pregnancy.
15531481 2004 Urocortin 1 in colonic mucosa in patients with ulcerative colitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15072543 2004 mRNA expression profiles for corticotrophin-releasing hormone, urocortin, CRH-binding protein and CRH receptors in human term gestational tissues determined by real-time quantitative RT-PCR.
14764822 2004 Corticotropin-releasing hormone system in human adipose tissue.
14576187 2004 Corticotropin-releasing hormone and its structurally related urocortin are synthesized and secreted by human mast cells.
14519439 2003 Protective effects of the urocortin homologues stresscopin (SCP) and stresscopin-related peptide (SRP) against hypoxia/reoxygenation injury in rat neonatal cardiomyocytes.
12535698 2002 Novel peptide-peptide cooperation may transform feeding behavior.
12519893 2003 Urocortin in human gastric mucosa: relationship to inflammatory activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175707 2002 Urocortin has cell-proliferative effects on cardiac non-myocytes.
12111693 2002 Expression of urocortin mRNA and peptide in the human prostate and in prostatic adenocarcinoma.
12010647 2002 Identification of urocortin mRNA and peptide in the human endometrium.
11836334 2002 Mutation screening of the urocortin gene: identification of new single nucleotide polymorphisms and association studies with obesity in French Caucasians.
11788672 2002 Expression of urocortin and corticotropin-releasing factor receptor subtypes in the human heart.
11416224 2001 Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor.
11329063 2001 Human stresscopin and stresscopin-related peptide are selective ligands for the type 2 corticotropin-releasing hormone receptor.
11238533 2001 Urocortin and corticotropin-releasing factor receptor expression in normal cycling human ovaries.
11150640 2000 Urocortin and corticotropin-releasing factor receptor expression in the human colonic mucosa.
10690896 2000 The skin produces urocortin.
10422876 1999 Urocortin in human placenta and maternal plasma.
10341863 1999 Urocortin expression in the human central nervous system.
9628819 1998 The structures of the mouse and human urocortin genes (Ucn and UCN).
9622018 1998 Regional distribution of urocortin-like immunoreactivity and expression of urocortin mRNA in the human brain.
9467598 1998 Human lymphocytes produce urocortin, but not corticotropin-releasing hormone.
9423932 1997 Labelling of CRF1 and CRF2 receptors using the novel radioligand, [3H]-urocortin.
9360550 1997 Urocortin expression in human pituitary gland and pituitary adenoma.
8612576 1996 The specificity of association of the IgD molecule with the accessory proteins BAP31/BAP29 lies in the IgD transmembrane sequence.
8612563 1996 Cloning and characterization of human urocortin.
861256 [Dynamics of matrix synthesis in molecular biophysics. II. Principle of insertability and the single-valued solution of feedback tasks].