Property Summary

NCBI Gene PubMed Count 36
PubMed Score 121.14
PubTator Score 48.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Neoplasm Metastasis 160 0.0 0.0
Disease Target Count Z-score Confidence
Retinal disease 23 0.0 0.9

Expression

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (12)

AA Sequence

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEE      1 - 70
EKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLEN     71 - 140
YDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCK    141 - 210
KFMERDPDELRFNAIALSAA                                                      211 - 230
//

Text Mined References (44)

PMID Year Title