Property Summary

NCBI Gene PubMed Count 11
PubMed Score 16.25
PubTator Score 2.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.500 2.7e-03
atypical teratoid / rhabdoid tumor 1.700 3.3e-04
glioblastoma 1.300 3.4e-03
group 4 medulloblastoma 1.100 8.2e-03
malignant mesothelioma 1.400 1.2e-05
medulloblastoma, large-cell 1.400 6.6e-05
non-small cell lung cancer 1.073 5.9e-13
oligodendroglioma 1.200 1.7e-02
osteosarcoma 1.523 1.8e-05
ovarian cancer 2.200 1.8e-05
pancreatic ductal adenocarcinoma liver m... 1.072 1.1e-02
Pick disease 1.700 2.8e-06
pituitary cancer -1.100 1.3e-03
primitive neuroectodermal tumor 1.700 2.8e-05
psoriasis -1.200 4.4e-03
sarcoidosis 1.100 1.0e-02
tuberculosis -1.200 2.3e-06

Gene RIF (4)

AA Sequence

MAAHGGSAASSALKGLIQQFTTITGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPSTSSASVSTVR      1 - 70
PHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAIDKKLTTLAD     71 - 140
LFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYHDS    141 - 210
EEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQLDVSSFLDQVTGFLGEHGQLDGLSSSPPKKCARSES    211 - 280
LIDASEDSQLEAAIRASLQETHFDSTQTKQDSRSDEESESELFSGSEEFISVCGSDEEEEVENLAKSRKS    281 - 350
PHKDLGHRKEENRRPLTEPPVRTDPGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYP    351 - 420
DGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQERN     421 - 489
//

Text Mined References (23)

PMID Year Title