Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.69
PubTator Score 6.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.8e-03

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.700 2.8e-03

Gene RIF (7)

PMID Text
26475856 UBXD1-N intercalates into the p97-ND1 interface, thereby modulating interdomain communication of p97 domains and its activity with relevance for disease pathogenesis
23335559 Data indicate that endosomal trafficking of CAV1 depends on ubiquitination of the N-terminal region and the subsequent recruitment of VCP-UBXD1.
22337587 UBXD1 modulates the trafficking of ERGIC-53-containing vesicles by controlling the interaction of transport factors with the cytoplasmic tail of ERGIC-53.
21822278 Data show that expression of VCP mutant proteins, or siRNA-mediated depletion of UBXD1 leads to a block of CAV1 transport at the limiting membrane of enlarged endosomes in cultured cells.
19275885 these findings suggest that UBXD1 is a regulatory component of endoplasmic reticulum-associated degradation that may modulate the adaptor binding to VCP.
19174149 An additional p97 binding site in UBXD1 that competed with the p47 cofactor for binding to the N domain of p97 was identified.
18656546 UBXD1 is a novel co-factor of the human p97 ATPase.

AA Sequence

MKKFFQEFKADIKFKSAGPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEAQMAAAAALARLEQKQSRA      1 - 70
WGPTSQDTIRNQVRKELQAEATVSGSPEAPGTNVVSEPREEGSAHLAVPGVYFTCPLTGATLRKDQRDAC     71 - 140
IKEAILLHFSTDPVAASIMKIYTFNKDQDRVKLGVDTIAKYLDNIHLHPEEEKYRKIKLQNKVFQERINC    141 - 210
LEGTHEFFEAIGFQKVLLPAQDQEDPEEFYVLSETTLAQPQSLERHKEQLLAAEPVRAKLDRQRRVFQPS    211 - 280
PLASQFELPGDFFNLTAEEIKREQRLRSEAVERLSVLRTKAMREKEEQRGLRKYNYTLLRVRLPDGCLLQ    281 - 350
GTFYARERLGAVYGFVREALQSDWLPFELLASGGQKLSEDENLALNECGLVPSALLTFSWDMAVLEDIKA    351 - 420
AGAEPDSILKPELLSAIEKLL                                                     421 - 441
//

Text Mined References (21)

PMID Year Title
26475856 2015 The N-terminal Region of the Ubiquitin Regulatory X (UBX) Domain-containing Protein 1 (UBXD1) Modulates Interdomain Communication within the Valosin-containing Protein p97.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
23335559 2013 Ubiquitination of the N-terminal region of caveolin-1 regulates endosomal sorting by the VCP/p97 AAA-ATPase.
22337587 2012 Protein interaction profiling of the p97 adaptor UBXD1 points to a role for the complex in modulating ERGIC-53 trafficking.
21896481 2011 The general definition of the p97/valosin-containing protein (VCP)-interacting motif (VIM) delineates a new family of p97 cofactors.
21822278 2011 Endolysosomal sorting of ubiquitylated caveolin-1 is regulated by VCP and UBXD1 and impaired by VCP disease mutations.
21269460 2011 Initial characterization of the human central proteome.
19275885 2009 UBXD1 is a VCP-interacting protein that is involved in ER-associated degradation.
19174149 2009 UBXD1 binds p97 through two independent binding sites.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18775313 2008 UBXD7 binds multiple ubiquitin ligases and implicates p97 in HIF1alpha turnover.
18768758 2008 Retraction for D. R. Zweitzig, N. Shcherbik, and D. S. Haines: AAA ATPase P97 and adaptor UBXD1 suppress MDM2 ubiquitination and degradation and promote constitutive P53 turnover.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18656546 2008 Ubxd1 is a novel co-factor of the human p97 ATPase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11342112 2001 Identification and characterization of UBXD1, a novel UBX domain-containing gene on human chromosome 19p13, and its mouse ortholog.