Property Summary

NCBI Gene PubMed Count 14
PubMed Score 37.97
PubTator Score 124.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.6e-07
atypical teratoid / rhabdoid tumor 5112 4.5e-04
ependymoma 4679 1.9e-02
Rheumatoid arthritis 1191 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cysticercosis 14 3.262 1.6
Chronic granulomatous disease 13 3.184 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.5e-04
ependymoma 1.800 1.9e-02
osteosarcoma -1.943 2.6e-07
Rheumatoid arthritis -1.800 2.6e-02

Gene RIF (3)

AA Sequence

MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIGAPVSRQVPAS      1 - 70
HDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAEATLQRQEELETMCVQLQRQV     71 - 140
REMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERDWMTAKKFWKPGDSLAPPEVDFDRLLASLQDLSEL    141 - 210
VVEGDTQVTPVPGGARLRTLEPIPLKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNG    211 - 280
VPFKVSDLRNQVYLEDGLDPFPGEGRVVGRQLMHKALDRVEEHPGSRMTAEKFLNRLPKFVIRQGEVIDI    281 - 350
RGPIRDTLQNCCPLPARIQEIVVETPTLAAERERSQESPNTPAPPLSMLRIKSENGEQAFLLMMQPDNTI    351 - 420
GDVRALLAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRARRAPKSSLKFSPGPCPGPG    421 - 490
PGPSPGPGPGPSPGPGPGPSPCPGPSPSPQ                                            491 - 520
//

Text Mined References (18)

PMID Year Title