Property Summary

NCBI Gene PubMed Count 14
PubMed Score 36.30
PubTator Score 124.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 2.6e-07
atypical teratoid / rhabdoid tumor 4369 4.5e-04
ependymoma 2514 1.9e-02
Rheumatoid Arthritis 1170 2.6e-02
Disease Target Count Z-score Confidence
Chronic granulomatous disease 13 3.205 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis -1.800 2.6e-02
ependymoma 1.800 1.9e-02
osteosarcoma -1.943 2.6e-07
atypical teratoid / rhabdoid tumor 1.200 4.5e-04

Gene RIF (3)

PMID Text
18974390 Both CD4+ and CD8+ T-cell responses against COA-1 can occur in colorectal cancer patients with metastatic disease
16202387 The rat homolog of UBXD5 promotes RhoA activation through G12/13 heterotrimeric G proteins
11940653 Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers

AA Sequence

MSSPLASLSKTRKVPLPSEPMNPGRRGIRIYGDEDEVDMLSDGCGSEEKISVPSCYGGIGAPVSRQVPAS      1 - 70
HDSELMAFMTRKLWDLEQQVKAQTDEILSKDQKIAALEDLVQTLRPHPAEATLQRQEELETMCVQLQRQV     71 - 140
REMERFLSDYGLQWVGEPMDQEDSESKTVSEHGERDWMTAKKFWKPGDSLAPPEVDFDRLLASLQDLSEL    141 - 210
VVEGDTQVTPVPGGARLRTLEPIPLKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNG    211 - 280
VPFKVSDLRNQVYLEDGLDPFPGEGRVVGRQLMHKALDRVEEHPGSRMTAEKFLNRLPKFVIRQGEVIDI    281 - 350
RGPIRDTLQNCCPLPARIQEIVVETPTLAAERERSQESPNTPAPPLSMLRIKSENGEQAFLLMMQPDNTI    351 - 420
GDVRALLAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRARRAPKSSLKFSPGPCPGPG    421 - 490
PGPSPGPGPGPSPGPGPGPSPCPGPSPSPQ                                            491 - 520
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18974390 2008 Induction of both CD8+ and CD4+ T-cell-mediated responses in colorectal cancer patients by colon antigen-1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16202387 2005 Socius, a novel binding partner of Galpha12/13, promotes the Galpha12-induced RhoA activation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14583468 2003 Identification of a colorectal tumor-associated antigen (COA-1) recognized by CD4(+) T lymphocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11940653 2002 Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.