Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.04
PubTator Score 5.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.4e-03
Breast cancer 2.700 3.1e-02
Duchenne muscular dystrophy 1.223 9.2e-08
gastric cancer 1.200 4.7e-03
group 3 medulloblastoma 1.200 3.9e-02
hepatocellular carcinoma 1.400 2.8e-05
juvenile dermatomyositis 1.397 3.1e-13
medulloblastoma, large-cell 1.100 6.3e-03
oligodendroglioma 1.100 5.4e-12
osteosarcoma 1.792 1.2e-05
pancreatic cancer 1.500 2.9e-03
pancreatic carcinoma 1.500 2.9e-03
primitive neuroectodermal tumor 1.100 3.9e-03
subependymal giant cell astrocytoma -1.452 2.1e-02
tuberculosis -1.800 4.2e-04

Synonym

Accession Q8WUN7 Q8TDQ3
Symbols DCUBP

Gene

PANTHER Protein Class (2)

PDB

1TTN   2KSN  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (4)

AA Sequence

MGGCVGAQHDSSGSLNENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEI      1 - 70
WDALKAAAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLD     71 - 140
IPEPPPNSGYECQLRLRLSTGKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEEL    141 - 210
KIPKDYVVQVIVSQPVQNPTPVEN                                                  211 - 234
//

Text Mined References (10)

PMID Year Title