Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.41
PubTator Score 1.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Intellectual disability 573
Disease Target Count P-value
ovarian cancer 8491 4.9e-05
dermatomyositis 966 4.9e-04
Multiple myeloma 1327 5.0e-03
Waldenstrons macroglobulinemia 764 6.8e-03

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.289 6.8e-03
Multiple myeloma 1.241 5.0e-03
ovarian cancer 2.000 4.9e-05
dermatomyositis 1.200 4.9e-04

Gene RIF (1)

PMID Text
24664117 These data provide the first evidence of ubiquitin ligase activity in mammalian spermatozoa and indicate UBR7 involvement in spermiogenesis.

AA Sequence

MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEE      1 - 70
PAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRP     71 - 140
YPDPEDEIPDEMIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAVTKISTEDDG    141 - 210
LVRNIDGIGDQEVIKPENGEHQDSTLKEDVPEQGKDDVREVKVEQNSEPCAGSSSESDLQTVFKNESLNA    211 - 280
ESKSGCKLQELKAKQLIKKDTATYWPLNWRSKLCTCQDCMKMYGDLDVLFLTDEYDTVLAYENKGKIAQA    281 - 350
TDRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKREDIQQFFEEFQSKKRRRVDGM    351 - 420
QYYCS                                                                     421 - 425
//

Text Mined References (11)

PMID Year Title
24664117 2014 Identification and characterization of RING-finger ubiquitin ligase UBR7 in mammalian spermatozoa.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18162545 2008 Synthetic heterovalent inhibitors targeting recognition E3 components of the N-end rule pathway.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.