Property Summary

NCBI Gene PubMed Count 50
PubMed Score 565.73
PubTator Score 115.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.100 2.3e-02
hereditary spastic paraplegia -1.150 1.0e-03
adrenocortical carcinoma 1.064 3.0e-04
pancreatic ductal adenocarcinoma liver m... 1.148 7.7e-03
Breast cancer 2.500 4.7e-02
group 3 medulloblastoma 1.200 1.5e-03
lung adenocarcinoma 1.203 6.1e-07
ovarian cancer 1.100 1.8e-02
dermatomyositis 1.300 9.6e-04

Gene RIF (34)

PMID Text
26464214 Study highlights many functional biological role of UBR5 especially in cancer where it seems to be a key regulator of cell signaling. [review]
26438829 Elevated metaphase RanGTP levels use Ubr5 to couple overall chromosome congression to SAC silencing.
26340541 Human herpesvirus-6 U14 induces cell cycle arrest in G2/M phase by associating with a cellular protein, EDD.
26234678 Colony-formation assays and soft agar assays show that gain of function of TIP60 or depletion of EDD1 in HPV-positive cervical cancer cells significantly inhibits cell growth in vitro
26224628 results confirm the role of the MLLE domain of UBR5 in substrate recruitment and suggest a potential role in regulating UBR5 ligase activity.
25833949 these observations highlight the potential role of EDD in regulating mitotic progression and the cellular response to perturbed mitosis.
24441042 Utilizing a high throughput RNAi screening approach author identified UBR5, a protein commonly amplified in breast cancer, as a novel regulator of ERalpha protein levels and transcriptional activity.
24438055 UBR5 knockdown results in accumulation of cellular pregnane X receptor and an increase in its activity.
24379240 These results identify EDD as a dual regulator of cell survival and cisplatin resistance and suggest that EDD is a therapeutic target for ovarian cancer.
24145130 the alpha4 N-terminus binding to endogenous PP2Ac and PABP, and the C-terminus to EDD, is reported.
24058416 Determined is the three-dimensional solution structure of the catalytic RING2 domain from HHARI. It shows glimpses of a HECT E3 ligase.
23878065 These findings suggest that expression of UBR5-ZNF423 protein might contribute to the transformation of a subset of Nasopharyngeal carcinoma
23612978 As a molecular adaptor, Vpr enhanced the interaction between TERT and the VPRBP substrate receptor of the DYRK2-associated EDD-DDB1-VPRBP E3 ligase complex, resulting in increased ubiquitination of TERT.
23612978 The interaction of HIV-1 Vpr with the EDVP E3 ligase complex (EDD, DDB1, and VPRBP) promotes Vpr-mediated downregulation of TERT protein
23407552 The recurrence and clustering of deleterious mutations implicate UBR5 mutations as a critical pathogenic event in a subgroup of mantle cell lymphoma.
23362280 Data indicate that Dyrk2 phosphorylates TERT protein, which is then associated with the EDD-DDB1-VprBP E3 ligase complex for subsequent ubiquitin-mediated TERT protein degradation.
23069210 Interaction between microspherule protein Msp58 and ubiquitin E3 ligase EDD regulates cell cycle progression.
23027739 Ubiquitination assays showed that the C-lobe of UBR5 is able to form a thioester-linked E3-ubiquitin complex, although it does not physically interact with UBCH4 in NMR experiments
22884692 Study shows that TRIP12 and UBR5, two HECT domain ubiquitin E3 ligases, control accumulation of RNF168, a rate-limiting component of a pathway that ubiquitylates histones after DNA breakage.
22374670 Increased p53 levels upon EDD depletion cause a G(1) arrest, as co-depletion of EDD and p53 completely rescues this effect on cell cycle progression.
21949371 EDD1 suppresses death-receptor expression, and its expression is elevated in breast, pancreas, and lung cancer cell lines resistant to death receptor-mediated apoptosis.
21383020 through binding to p53, EDD actively inhibits p53 phosphorylation by ATM and plays a role in ensuring smooth G(1)/S progression.
21228227 The authors show that human EDD can interact independently with both human papillomavirus type 18 E6 and human E6AP.
21127351 identify UBR5 as a novel E3 ligase that regulates transcription and define an additional function of TFIIS in the regulation of CDK9.
21118991 EDD ubiquitinates beta-catenin through Lys29- or Lys11-linked ubiquitin chains, leading to enhanced stability of beta-catenin.
20544796 Data show that in addition to PP2Ac, alpha4 interacts with EDD and PABP, suggesting its involvement in multiple steps in the mTOR pathway that leads to translation initiation and cell-cycle progression.
20025491 study confirmed the presence of UBR5 mutation in exon 45 in high microsatellite instability cacarcinomas; could not identify exon 42 mutations in colorectal cancers and exon 51 mutations in breast cancers
18976975 Knockdown of ubiquitin protein ligase E3 component n-recognin 5 (UBR5) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18349819 These results identify EDD as a new independent prognostic marker for outcome in serous ovarian cancer
18073532 EDD plays the role in the maintenance of genomic stability, emphasising the potential importance of dysregulated EDD expression and/or function in the evolution of cancer.
17855541 The interaction of HIV-1 Vpr with the EDVP E3 ligase complex (EDD, DDB1, and VPRBP) promotes Vpr-mediated downregulation of TERT protein
17360488 The interaction of HIV-1 Vpr with the EDVP E3 ligase complex (EDD, DDB1, and VPRBP) promotes Vpr-mediated downregulation of TERT protein
17074762 EDD is a novel mediator in DNA damage signal transduction via CHK2 and emphasize the potential importance of EDD in cancer.
12011095 ubiquitin-protein ligase EDD interacts with importin alpha 5 through consensus basic nuclear localization signals and is localized in cell nuclei. EDD also binds progesterone receptor (PR) and potentiates progestin-mediated gene transactivation.

AA Sequence

MTSIHFVVHPLPGTEDQLNDRLREVSEKLNKYNLNSHPPLNVLEQATIKQCVVGPNHAAFLLEDGRVCRI      1 - 70
GFSVQPDRLELGKPDNNDGSKLNSNSGAGRTSRPGRTSDSPWFLSGSETLGRLAGNTLGSRWSSGVGGSG     71 - 140
GGSSGRSSAGARDSRRQTRVIRTGRDRGSGLLGSQPQPVIPASVIPEELISQAQVVLQGKSRSVIIRELQ    141 - 210
RTNLDVNLAVNNLLSRDDEDGDDGDDTASESYLPGEDLMSLLDADIHSAHPSVIIDADAMFSEDISYFGY    211 - 280
PSFRRSSLSRLGSSRVLLLPLERDSELLRERESVLRLRERRWLDGASFDNERGSTSKEGEPNLDKKNTPV    281 - 350
QSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLT    351 - 420
NEKIVLLSANSIRATVATENNKVATWVDETLSSVASKLEHTAQTYSELQGERIVSLHCCALYTCAQLENS    421 - 490
LYWWGVVPFSQRKKMLEKARAKNKKPKSSAGISSMPNITVGTQVCLRNNPLYHAGAVAFSISAGIPKVGV    491 - 560
LMESVWNMNDSCRFQLRSPESLKNMEKASKTTEAKPESKQEPVKTEMGPPPSPASTCSDASSIASSASMP    561 - 630
YKRRRSTPAPKEEEKVNEEQWSLREVVFVEDVKNVPVGKVLKVDGAYVAVKFPGTSSNTNCQNSSGPDAD    631 - 700
PSSLLQDCRLLRIDELQVVKTGGTPKVPDCFQRTPKKLCIPEKTEILAVNVDSKGVHAVLKTGNWVRYCI    701 - 770
FDLATGKAEQENNFPTSSIAFLGQNERNVAIFTAGQESPIILRDGNGTIYPMAKDCMGGIRDPDWLDLPP    771 - 840
ISSLGMGVHSLINLPANSTIKKKAAVIIMAVEKQTLMQHILRCDYEACRQYLMNLEQAVVLEQNLQMLQT    841 - 910
FISHRCDGNRNILHACVSVCFPTSNKETKEEEEAERSERNTFAERLSAVEAIANAISVVSSNGPGNRAGS    911 - 980
SSSRSLRLREMMRRSLRAAGLGRHEAGASSSDHQDPVSPPIAPPSWVPDPPAMDPDGDIDFILAPAVGSL    981 - 1050
TTAATGTGQGPSTSTIPGPSTEPSVVESKDRKANAHFILKLLCDSVVLQPYLRELLSAKDARGMTPFMSA   1051 - 1120
VSGRAYPAAITILETAQKIAKAEISSSEKEEDVFMGMVCPSGTNPDDSPLYVLCCNDTCSFTWTGAEHIN   1121 - 1190
QDIFECRTCGLLESLCCCTECARVCHKGHDCKLKRTSPTAYCDCWEKCKCKTLIAGQKSARLDLLYRLLT   1191 - 1260
ATNLVTLPNSRGEHLLLFLVQTVARQTVEHCQYRPPRIREDRNRKTASPEDSDMPDHDLEPPRFAQLALE   1261 - 1330
RVLQDWNALKSMIMFGSQENKDPLSASSRIGHLLPEEQVYLNQQSGTIRLDCFTHCLIVKCTADILLLDT   1331 - 1400
LLGTLVKELQNKYTPGRREEAIAVTMRFLRSVARVFVILSVEMASSKKKNNFIPQPIGKCKRVFQALLPY   1401 - 1470
AVEELCNVAESLIVPVRMGIARPTAPFTLASTSIDAMQGSEELFSVEPLPPRPSSDQSSSSSQSQSSYII   1471 - 1540
RNPQQRRISQSQPVRGRDEEQDDIVSADVEEVEVVEGVAGEEDHHDEQEEHGEENAEAEGQHDEHDEDGS   1541 - 1610
DMELDLLAAAETESDSESNHSNQDNASGRRSVVTAATAGSEAGASSVPAFFSEDDSQSNDSSDSDSSSSQ   1611 - 1680
SDDIEQETFMLDEPLERTTNSSHANGAAQAPRSMQWAVRNTQHQRAASTAPSSTSTPAASSAGLIYIDPS   1681 - 1750
NLRRSGTISTSAAAAAAALEASNASSYLTSASSLARAYSIVIRQISDLMGLIPKYNHLVYSQIPAAVKLT   1751 - 1820
YQDAVNLQNYVEEKLIPTWNWMVSIMDSTEAQLRYGSALASAGDPGHPNHPLHASQNSARRERMTAREEA   1821 - 1890
SLRTLEGRRRATLLSARQGMMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKA   1891 - 1960
MNQQTTLDTPQLERKRTRELLELGIDNEDSEHENDDDTNQSATLNDKDDDSLPAETGQNHPFFRRSDSMT   1961 - 2030
FLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSASSGKCLMEVTVDRNCLEVLPT   2031 - 2100
KMSYAANLKNVMNMQNRQKKEGEEQPVLPEETESSKPGPSAHDLAAQLKSSLLAEIGLTESEGPPLTSFR   2101 - 2170
PQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDL   2171 - 2240
SLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLP   2241 - 2310
NLECIQNANKGTHTSLMQRLRNRGERDREREREREMRRSSGLRAGSRRDRDRDFRRQLSIDTRPFRPASE   2311 - 2380
GNPSDDPEPLPAHRQALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVDEAMELII   2381 - 2450
AHGRENGADSILDLGLVDSSEKVQQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPRPGK   2451 - 2520
NTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSD   2521 - 2590
ADAVFSAMDLAFAIDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLD   2591 - 2660
VLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVEKMSMTERQDLV   2661 - 2730
YFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV    2731 - 2799
//

Text Mined References (66)

PMID Year Title
26464214 2015 Functional Roles of the E3 Ubiquitin Ligase UBR5 in Cancer.
26438829 2015 RanGTP aids anaphase entry through Ubr5-mediated protein turnover.
26340541 2015 Human Herpesvirus-6 U14 Induces Cell-Cycle Arrest in G2/M Phase by Associating with a Cellular Protein, EDD.
26234678 2016 E3 ligase EDD1/UBR5 is utilized by the HPV E6 oncogene to destabilize tumor suppressor TIP60.
26224628 2015 The MLLE domain of the ubiquitin ligase UBR5 binds to its catalytic domain to regulate substrate binding.
25833949 2015 EDD, a ubiquitin-protein ligase of the N-end rule pathway, associates with spindle assembly checkpoint components and regulates the mitotic response to nocodazole.
24656813 2014 Phosphorylation-dependent PIH1D1 interactions define substrate specificity of the R2TP cochaperone complex.
24441042 2015 Systems level-based RNAi screening by high content analysis identifies UBR5 as a regulator of estrogen receptor-? protein levels and activity.
24438055 2014 Stability of the human pregnane X receptor is regulated by E3 ligase UBR5 and serine/threonine kinase DYRK2.
24379240 2014 EDD enhances cell survival and cisplatin resistance and is a therapeutic target for epithelial ovarian cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24145130 2014 Progestin-inducible EDD E3 ubiquitin ligase binds to ?4 phosphoprotein to regulate ubiquitination and degradation of protein phosphatase PP2Ac.
24058416 2013 Structure of the HHARI catalytic domain shows glimpses of a HECT E3 ligase.
23878065 2013 Identification of a recurrent transforming UBR5-ZNF423 fusion gene in EBV-associated nasopharyngeal carcinoma.
23612978 2013 HIV-1 Vpr protein inhibits telomerase activity via the EDD-DDB1-VPRBP E3 ligase complex.
23407552 2013 The E3 ubiquitin ligase UBR5 is recurrently mutated in mantle cell lymphoma.
23362280 2013 Dyrk2-associated EDD-DDB1-VprBP E3 ligase inhibits telomerase by TERT degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23069210 2013 The novel interaction between microspherule protein Msp58 and ubiquitin E3 ligase EDD regulates cell cycle progression.
23027739 2012 Structure of the HECT C-lobe of the UBR5 E3 ubiquitin ligase.
22884692 2012 TRIP12 and UBR5 suppress spreading of chromatin ubiquitylation at damaged chromosomes.
22374670 2012 EDD induces cell cycle arrest by increasing p53 levels.
21949371 2011 A whole-genome RNAi screen identifies an 8q22 gene cluster that inhibits death receptor-mediated apoptosis.
21924388 2011 Identification of phosphorylation sites on the E3 ubiquitin ligase UBR5/EDD.
21726808 2011 Acetylation regulates gluconeogenesis by promoting PEPCK1 degradation via recruiting the UBR5 ubiquitin ligase.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21383020 2011 EDD inhibits ATM-mediated phosphorylation of p53.
21269460 2011 Initial characterization of the human central proteome.
21228227 2011 Regulation of the human papillomavirus type 18 E6/E6AP ubiquitin ligase complex by the HECT domain-containing protein EDD.
21127351 2011 Transcription factor IIS cooperates with the E3 ligase UBR5 to ubiquitinate the CDK9 subunit of the positive transcription elongation factor B.
21118991 2011 The EDD E3 ubiquitin ligase ubiquitinates and up-regulates beta-catenin.
20544796 2010 alpha4 phosphoprotein interacts with EDD E3 ubiquitin ligase and poly(A)-binding protein.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20025491 2010 Mutational analysis of UBR5 gene encoding an E3 ubiquitin ligase in common human cancers.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19287380 2009 Protein kinase DYRK2 is a scaffold that facilitates assembly of an E3 ligase.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18349819 2008 The E3 ubiquitin ligase EDD is an adverse prognostic factor for serous epithelial ovarian cancer and modulates cisplatin resistance in vitro.
18076571 2007 Putative tumor suppressor EDD interacts with and up-regulates APC.
18073532 2007 The E3 ubiquitin ligase EDD regulates S-phase and G(2)/M DNA damage checkpoints.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17074762 2006 EDD mediates DNA damage-induced activation of CHK2.
16601676 2006 Poly(A) binding protein (PABP) homeostasis is mediated by the stability of its inhibitor, Paip2.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
16055722 2005 A family of mammalian E3 ubiquitin ligases that contain the UBR box motif and recognize N-degrons.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12902990 2003 EDD, the human orthologue of the hyperplastic discs tumour suppressor gene, is amplified and overexpressed in cancer.
12840015 2003 Nuclear coactivator-62 kDa/Ski-interacting protein is a nuclear matrix-associated coactivator that may couple vitamin D receptor-mediated transcription and RNA splicing.
12594221 2003 Identification of novel ERK2 substrates through use of an engineered kinase and ATP analogs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12011095 2002 EDD, the human hyperplastic discs protein, has a role in progesterone receptor coactivation and potential involvement in DNA damage response.
11714696 2002 Cooperation of HECT-domain ubiquitin ligase hHYD and DNA topoisomerase II-binding protein for DNA damage response.
11287654 2001 X-ray structure of the human hyperplastic discs protein: an ortholog of the C-terminal domain of poly(A)-binding protein.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10030672 1998 Identification of a human HECT family protein with homology to the Drosophila tumor suppressor gene hyperplastic discs.