Property Summary

NCBI Gene PubMed Count 12
PubMed Score 47.42
PubTator Score 13.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 9.2e-12
osteosarcoma 7950 4.1e-04
breast carcinoma 1638 5.6e-04
ovarian cancer 8520 9.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.200 5.6e-04
juvenile dermatomyositis 1.258 9.2e-12
osteosarcoma -1.031 4.1e-04
ovarian cancer -1.100 9.6e-04

Gene RIF (6)

AA Sequence

MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQEDSSLPLDGETEHPPFQYVMCA      1 - 70
ATSPAVKLHDETLTYLNQGQSYEIRMLDNRKMGDMPEINGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWN     71 - 140
RPGDRLLDLDIPMSVGIIDTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQV    141 - 210
DTFKQNENGEYTDHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAHEKEKYQPSYDTTILTEMRLEPII    211 - 280
EDAVEHEQKKSSKRTLPADYGDSLAKRGSCSPWPDAPTAYVNNSPSPAPTFTSPQQSTCSVPDSNSSSPN    281 - 350
HQGDGASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKEDLVQICGAADGIRLYNS    351 - 420
LKSRSVRPRLTIYVCREQPSSTVLQGQQQAASSASENGSGAPYVYHAIYLEEMIASEVARKLALVFNIPL    421 - 490
HQINQVYRQGPTGIHILVSDQMVQNFQDESCFLFSTVKAESSDGIHIILK                        491 - 540
//

Text Mined References (14)

PMID Year Title