Property Summary

NCBI Gene PubMed Count 17
PubMed Score 26.52
PubTator Score 14.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Hydrops Fetalis, Non-Immune 12
Disease Target Count P-value
osteosarcoma 7933 6.9e-12
Pick disease 1893 5.9e-07
ovarian cancer 8491 1.1e-06
malignant mesothelioma 3163 2.0e-05
psoriasis 6685 1.4e-04
Disease Target Count
Non-immune hydrops fetalis 11

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 2.0e-05
psoriasis -2.200 1.4e-04
osteosarcoma -3.162 6.9e-12
Pick disease 1.100 5.9e-07
ovarian cancer 1.400 1.1e-06

Gene RIF (7)

PMID Text
26159857 study points to UBN1 as the determinant of H3.3-specific binding and deposition by the HIRA histone chaperone complex.
22401310 NHRD domain of UBN1 as being an essential region for HIRA interaction and chromatin organization by the HUCA complex
22245583 a 184-amino acid region (from amino acids 39 to 223) at the N-terminal region of Ubn-1 was responsible for the interaction with the PDZ2 domain of ZO-1
21807893 Data show that, like HIRA, UBN1, and ASF1a, CABIN1 is involved in heterochromatinization of the genome of senescent human cells.
21084479 By a chromatin immunoprecipitation (ChIP) assay, the authors show that Ubn-1 blocks EB1-human herpesvirus 4 DNA interaction.
19029251 Hpc2-related domain of UBN1, UBN2, and Hpc2p is an evolutionarily conserved HIRA/Hir-binding domain, which directly interacts with the N-terminal WD repeats of HIRA/Hir.
18823282 Analyses have revealed that in most cells ubinuclein occurred in the nucleoplasm, but in cells forming tight junctions it is recruited to the plaque structure of the zonula occludens.

AA Sequence

MSEPHRVQFTSLPGSLNPAFLKKSRKEEAGAGEQHQDCEPAAAAVRITLTLFEPDHKRCPEFFYPELVKN      1 - 70
IRGKVKGLQPGDKKKDLSDPFNDEEKERHKVEALARKFEEKYGGKKRRKDRIQDLIDMGYGYDESDSFID     71 - 140
NSEAYDELVPASLTTKYGGFYINSGTLQFRQASESEDDFIKEKKKKSPKKRKLKEGGEKIKKKKKDDTYD    141 - 210
KEKKSKKSKFSKAGFTALNASKEKKKKKYSGALSVKEMLKKFQKEKEAQKKREEEHKPVAVPSAEAQGLR    211 - 280
ELEGASDPLLSLFGSTSDNDLLQAATAMDSLTDLDLEHLLSESPEGSPFRDMDDGSDSLGVGLDQEFRQP    281 - 350
SSLPEGLPAPLEKRVKELAQAARAAEGESRQKFFTQDINGILLDIEAQTRELSSQVRSGVYAYLASFLPC    351 - 420
SKDALLKRARKLHLYEQGGRLKEPLQKLKEAIGRAMPEQMAKYQDECQAHTQAKVAKMLEEEKDKEQRDR    421 - 490
ICSDEEEDEEKGGRRIMGPRKKFQWNDEIRELLCQVVKIKLESQDLERNNKAQAWEDCVKGFLDAEVKPL    491 - 560
WPKGWMQARTLFKESRRGHGHLTSILAKKKVMAPSKIKVKESSTKPDKKVSVPSGQIGGPIALPSDHQTG    561 - 630
GLSIGASSRELPSQASGGLANPPPVNLEDSLDEDLIRNPASSVEAVSKELAALNSRAAGNSEFTLPAPSK    631 - 700
APAEKVGGVLCTEEKRNFAKPSPSAPPPASSLQSPLNFLAEQALALGQSSQEKKPESSGYKELSCQAPLN    701 - 770
KGLPEVHQSKAKHHSLPRTSHGPQVAVPVPGPQVKVFHAGTQQQKNFTPPSPFANKLQGPKASPTQCHRS    771 - 840
LLQLVKTAAKGQGFHPSAPATSGGLSASSSSSHKTPASSSSALSHPAKPHSVSSAGSSYKNNPFASSISK    841 - 910
HGVSSGSSSSGGTPVQSSVSGSLVPGIQPPSVGQATSRPVPSSAGKKMPVSQKLTLVAPPGGPNGDSSGG    911 - 980
TQGVAKLLTSPSLKPSAVSSVTSSTSLSKGASGTVLLAGSSLMASPYKSSSPKLSGAMSSNSLGIITPVP    981 - 1050
IPVHVLSFSADSSAKAGVSKDAIVTGPAPGSFHHGLGHSLLAGLHSSPPHAAPLPHAAVPTHIPQSLPGA   1051 - 1120
SQLHGKGPAVPRKL                                                           1121 - 1134
//

Text Mined References (24)

PMID Year Title
27871933 2016 A Molecular Prospective for HIRA Complex Assembly and H3.3-Specific Histone Chaperone Function.
26159857 2015 Ubinuclein-1 confers histone H3.3-specific-binding by the HIRA histone chaperone complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22401310 2012 Identification of an ubinuclein 1 region required for stability and function of the human HIRA/UBN1/CABIN1/ASF1a histone H3.3 chaperone complex.
22245583 2012 Identification of new interacting partners of the shuttling protein ubinuclein (Ubn-1).
21807893 2011 Human CABIN1 is a functional member of the human HIRA/UBN1/ASF1a histone H3.3 chaperone complex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21084479 2011 The nuclear and adherent junction complex component protein ubinuclein negatively regulates the productive cycle of Epstein-Barr virus in epithelial cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
19029251 2009 Human UBN1 is an ortholog of yeast Hpc2p and has an essential role in the HIRA/ASF1a chromatin-remodeling pathway in senescent cells.
18823282 2009 Characterization of the ubinuclein protein as a new member of the nuclear and adhesion complex components (NACos).
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10725330 2000 Ubinuclein, a novel nuclear protein interacting with cellular and viral transcription factors.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.