Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.02
PubTator Score 6.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis 1.200 4.2e-02
osteosarcoma -1.257 3.4e-03
autosomal dominant Emery-Dreifuss muscul... 1.196 7.6e-04
juvenile dermatomyositis 1.450 2.3e-11
Pick disease -1.100 1.1e-03
ovarian cancer 1.200 5.3e-05

Synonym

Accession Q8WVY7 D3DQJ7 Q96DK5
Symbols CPUB1

Gene

PDB

2KX3   2LGD   2M17  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
23667555 the high-resolution solution structure of the UBL domain of human UBLCP1 and its interaction with Rpn1
21949367 UBLCP1 is a 26S proteasome phosphatase that regulates nuclear proteasome activity

AA Sequence

MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNT      1 - 70
KIMMMGTREESLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLL     71 - 140
VLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFM    141 - 210
LDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDK    211 - 280
DKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ                                    281 - 318
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23667555 2013 Solution structure and Rpn1 interaction of the UBL domain of human RNA polymerase II C-terminal domain phosphatase.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21949367 2011 UBLCP1 is a 26S proteasome phosphatase that regulates nuclear proteasome activity.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15883030 2005 Cloning and characterization of a novel RNA polymerase II C-terminal domain phosphatase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.