Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.78
PubTator Score 232.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.5e-04
Multiple myeloma 1332 3.6e-03

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.220 3.6e-03
psoriasis 1.600 1.5e-04

Gene RIF (8)

AA Sequence

MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLEL      1 - 70
YYQ                                                                        71 - 73
//

Text Mined References (23)

PMID Year Title