Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.10
PubTator Score 44.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.100 9.5e-03
ependymoma 1.700 1.0e-02
sonic hedgehog group medulloblastoma -2.000 1.1e-07
atypical teratoid / rhabdoid tumor -1.600 6.1e-08
glioblastoma -1.100 4.8e-04
medulloblastoma, large-cell -2.000 7.7e-07
Atopic dermatitis -1.500 5.3e-05
non-small cell lung cancer -1.662 3.9e-26
lung cancer -2.800 1.0e-04
Breast cancer 3.100 3.0e-02
cystic fibrosis -1.200 1.5e-04
lung adenocarcinoma -2.200 3.7e-14
nasopharyngeal carcinoma -1.100 2.1e-05
spina bifida -1.560 3.6e-02
Pick disease -1.100 6.1e-04
progressive supranuclear palsy -1.100 8.0e-03
gastric carcinoma -1.500 3.5e-02
ovarian cancer -2.000 2.3e-08

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGN      1 - 70
VTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL                            71 - 117
//

Text Mined References (18)

PMID Year Title
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20460270 2010 Genome-wide association study identifies a susceptibility locus for biliary atresia on 10q24.2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17567738 2007 Solution structure of a membrane-anchored ubiquitin-fold (MUB) protein from Homo sapiens.
16831869 2006 MUBs, a family of ubiquitin-fold proteins that are plasma membrane-anchored by prenylation.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10375635 1999 Cloning, mapping and expression of UBL3, a novel ubiquitin-like gene.