Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.75
PubTator Score 13.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.892 2.4e-05
atypical teratoid / rhabdoid tumor 1.200 1.5e-04
glioblastoma 1.900 4.6e-04
group 4 medulloblastoma 1.800 2.3e-04
medulloblastoma, large-cell 2.100 7.6e-05
lung cancer 1.200 2.0e-02
diabetes mellitus 2.000 1.6e-03
pediatric high grade glioma 1.400 5.1e-04
psoriasis 1.100 1.0e-07
ovarian cancer 2.600 7.0e-05

 GWAS Trait (1)

Gene RIF (12)

PMID Text
26067607 data reveal that high UBE3C expression contributes to glioma progression by ubiquitination and degradation of ANXA7, and thus presents a novel and promising target for glioma therapy.
25658088 these observations suggest that UBE3C plays an important role in RCC development and progression, and UBE3C may be a novel target for prevention and treatment of ccRCC.
24425307 UBE3C is a mutant candidate oncogene involved in tumor development and progression of hepatocellular carcinoma.
24158444 knockdown renders cells more susceptible to the Hsp90 inhibitor 17-AAG, suggesting that UBE3C protects against the harmful accumulation of protein fragments arising from incompletely degraded proteasome substrates.
21881582 Our findings provide evidence that variations in UBE3C are potent genetic markers of nasal polyps development in Korean asthmatics.
21167755 negatively regulates type I interferon through ubiquitination of the transcription factors
20934631 gene polymorphism is associated with the risk of Aspirin-intolerant asthma
20934631 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19846067 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12692129 TIP120B is a specific substrate of KIAA10; both are highly expressed in human skeletal muscle, suggesting that KIAA10 may regulate TIP120B homeostasis specifically in this tissue.

AA Sequence

MFSFEGDFKTRPKVSLGGASRKEEKASLLHRTQEERRKREEERRRLKNAIIIQSFIRGYRDRKQQYSIQR      1 - 70
SAFDRCATLSQSGGAFPIANGPNLTLLVRQLLFFYKQNEDSKRLIWLYQNLIKHSSLFVKQLDGSERLTC     71 - 140
LFQIKRLMSLCCRLLQNCNDDSLNVALPMRMLEVFSSENTYLPVLQDASYVVSVIEQILHYMIHNGYYRS    141 - 210
LYLLINSKLPSSIEYSDLSRVPIAKILLENVLKPLHFTYNSCPEGARQQVFTAFTEEFLAAPFTDQIFHF    211 - 280
IIPALADAQTVFPYEPFLNALLLIESRCSRKSGGAPWLFYFVLTVGENYLGALSEEGLLVYLRVLQTFLS    281 - 350
QLPVSPASASCHDSASDSEEESEEADKPSSPEDGRLSVSYITEECLKKLDTKQQTNTLLNLVWRDSASEE    351 - 420
VFTTMASVCHTLMVQHRMMVPKVRLLYSLAFNARFLRHLWFLISSMSTRMITGSMVPLLQVISRGSPMSF    421 - 490
EDSSRIIPLFYLFSSLFSHSLISIHDNEFFGDPIEVVGQRQSSMMPFTLEELIMLSRCLRDACLGIIKLA    491 - 560
YPETKPEVREEYITAFQSIGVTTSSEMQQCIQMEQKRWIQLFKVITNLVKMLKSRDTRRNFCPPNHWLSE    561 - 630
QEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSEERQLAVLTELPFVVPFEERVK    631 - 700
IFQRLIYADKQEVQGDGPFLDGINVTIRRNYIYEDAYDKLSPENEPDLKKRIRVHLLNAHGLDEAGIDGG    701 - 770
GIFREFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFA    771 - 840
GFFLSKLLGTSADVDIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKFGGKDIP    841 - 910
VTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQVPISLEDLKSFT    911 - 980
NYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPAFCIHNGGSDLERLPTAST    981 - 1050
CMNLLKLPEFYDETLLRSKLLYAIECAAGFELS                                        1051 - 1083
//

Text Mined References (26)

PMID Year Title
26067607 2015 Ubiquitin-protein ligase E3C promotes glioma progression by mediating the ubiquitination and degrading of Annexin A7.
25658088 2015 UBE3C promotes growth and metastasis of renal cell carcinoma via activating Wnt/?-catenin pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24425307 2014 Clinical significance of the ubiquitin ligase UBE3C in hepatocellular carcinoma revealed by exome sequencing.
24158444 2013 The E3 ubiquitin ligase UBE3C enhances proteasome processivity by ubiquitinating partially proteolyzed substrates.
21881582 2011 UBE3C genetic variations as potent markers of nasal polyps in Korean asthma patients.
21269460 2011 Initial characterization of the human central proteome.
21167755 2010 The ubiquitin E3 ligase RAUL negatively regulates type i interferon through ubiquitination of the transcription factors IRF7 and IRF3.
20934631 2010 Association analysis of UBE3C polymorphisms in Korean aspirin-intolerant asthmatic patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19846067 2010 A genomewide association study of citalopram response in major depressive disorder.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
17323924 2007 Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
16601690 2006 Molecular determinants of polyubiquitin linkage selection by an HECT ubiquitin ligase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341092 2005 Different HECT domain ubiquitin ligases employ distinct mechanisms of polyubiquitin chain synthesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12692129 2003 Proteolytic targeting of transcriptional regulator TIP120B by a HECT domain E3 ligase.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278995 2001 A HECT domain E3 enzyme assembles novel polyubiquitin chains.
9575161 1998 Characterization of human hect domain family members and their interaction with UbcH5 and UbcH7.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.