Property Summary

NCBI Gene PubMed Count 33
PubMed Score 49.67
PubTator Score 35.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -2.000 2.7e-03
ependymoma -1.900 8.9e-03
oligodendroglioma -1.900 7.1e-03
glioblastoma multiforme -1.200 1.6e-26
atypical teratoid / rhabdoid tumor -1.500 2.2e-05
adult high grade glioma -1.300 2.0e-04
Pick disease -1.600 2.7e-03
ovarian cancer 1.700 5.5e-04

Synonym

Accession Q15819
Symbols MMS2
UEV2
EDPF1
UEV-2
DDVIT1
EDAF-1
EDPF-1
DDVit-1

Gene

PDB

1ZGU   5AIT   1J7D   3VON   4NR3   4NRG   4NRI   4ONL   4ONM   4ONN   4ORH   1J74  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

PMID Text
26148049 Data suggest that ubiquitin-conjugating enzyme E2 variant 2 (Ube2V2) and ring finger protein 4 (RNF4) together induce an active conformation of the ubiquitin-conjugating enzyme Ubc13-ubiquitin (Ubc13~Ub) thioester.
25910425 Functional analysis of selected regulated proteins revealed that knockdown of HNRPD, PHB2 and UB2V2 can increase HCMV replication, while knockdown of A4 and KSRP resulted in decreased HCMV replication.
24846979 suppression of hMMS2 reverses L-OHP tolerance in differentiated human colorectal carcinoma cells by promoting apoptosis
22679021 the crystal structure of human OTUB1 in complex with human UBC13 and MMS2
22589545 Data show RING finger (RNF) E3 ubiquitin ligase RNF8 dimerizes and binds to E2 ubiquitin-conjugating complex Ubc13/Mms2 with formation of Lys-63 ubiquitin chains, whereas the RNF168 RING domain is a monomer and does not catalyze Lys-6 ubiquitylation.
21774837 entire coding region and splice junctions of RNF8, UBC13 and MMS2 genes were screened for mutations in affected index cases from 123 Northern Finnish breast cancer families
18284681 These results point to a high level of redundancy in the DNA damage tolerance pathway and suggest the existence of another hMMS2 variant (hMMSv) or complex that can compensate for its loss.
17964296 Mms2 physical association with ubiquitin is correlated with its ability to promote Lys63-linked ubiquitin chain assembly
16129784 Data demonstrate that divergent activities of Ubc13 rely on its pairing with either of two Uevs, Uev1A or Mms2.
15952783 Insight into the influence of protein dynamics on the affinity of ubiquitin for Mms2.
15749714 The results in this study allowed identification of important residues of the Ubc13-Mms2 interface, determine a correlation between heterodimer formation and function, and conclude why Mms2 forms a specific complex with Ubc13 but not other Ubc proteins.
15725630 UBE2v2 signalling through PCNA ubiquitination is not required for immunoglobulin diversification in DT40 cells.
14562038 Ubc13-Mms2 and Lys63-polyubiquitin chains are associated with signaling cellular stress

AA Sequence

MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECG      1 - 70
PKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG     71 - 140
QTYNN                                                                     141 - 145
//

Text Mined References (37)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26148049 2015 Structural basis for the RING-catalyzed synthesis of K63-linked ubiquitin chains.
25910425 2015 Subcellular quantitative proteomic analysis reveals host proteins involved in human cytomegalovirus infection.
24846979 2014 [Roles of hMMS2 gene in reversing the oxaliplatin tolerance of human colon carcinoma cells].
24076975 2013 The tomato Fni3 lysine-63-specific ubiquitin-conjugating enzyme and suv ubiquitin E2 variant positively regulate plant immunity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22679021 2012 Molecular basis of Lys-63-linked polyubiquitination inhibition by the interaction between human deubiquitinating enzyme OTUB1 and ubiquitin-conjugating enzyme UBC13.
22589545 2012 Molecular insights into the function of RING finger (RNF)-containing proteins hRNF8 and hRNF168 in Ubc13/Mms2-dependent ubiquitylation.
22325355 2012 OTUB1 co-opts Lys48-linked ubiquitin recognition to suppress E2 enzyme function.
21774837 2011 Mutation screening of the RNF8, UBC13 and MMS2 genes in Northern Finnish breast cancer families.
21269460 2011 Initial characterization of the human central proteome.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
18284681 2008 hMMS2 serves a redundant role in human PCNA polyubiquitination.
18178771 2008 Arabidopsis UEV1D promotes Lysine-63-linked polyubiquitination and is involved in DNA damage response.
17964296 2007 Two Mms2 residues cooperatively interact with ubiquitin and are critical for Lys63 polyubiquitination in vitro and in vivo.
17349954 2007 A critical role for the ubiquitin-conjugating enzyme Ubc13 in initiating homologous recombination.
16786304 2006 Arabidopsis thaliana UBC13: implication of error-free DNA damage tolerance and Lys63-linked polyubiquitylation in plants.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16129784 2005 Distinct regulation of Ubc13 functions by the two ubiquitin-conjugating enzyme variants Mms2 and Uev1A.
15952783 2005 Main chain and side chain dynamics of the ubiquitin conjugating enzyme variant human Mms2 in the free and ubiquitin-bound States.
15749714 2005 A single Mms2 "key" residue insertion into a Ubc13 pocket determines the interface specificity of a human Lys63 ubiquitin conjugation complex.
15725630 2005 UBE2V2 (MMS2) is not required for effective immunoglobulin gene conversion or DNA damage tolerance in DT40.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695475 2004 Bcl10 activates the NF-kappaB pathway through ubiquitination of NEMO.
14562038 2003 The Chfr mitotic checkpoint protein functions with Ubc13-Mms2 to form Lys63-linked polyubiquitin chains.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11473255 2001 Crystal structure of the human ubiquitin conjugating enzyme complex, hMms2-hUbc13.
11473244 2001 Defining polyubiquitin chain topology.
10089880 1999 Noncanonical MMS2-encoded ubiquitin-conjugating enzyme functions in assembly of novel polyubiquitin chains for DNA repair.
9705497 1998 The products of the yeast MMS2 and two human homologs (hMMS2 and CROC-1) define a structurally and functionally conserved Ubc-like protein family.
9418904 1998 Role of UEV-1, an inactive variant of the E2 ubiquitin-conjugating enzymes, in in vitro differentiation and cell cycle behavior of HT-29-M6 intestinal mucosecretory cells.
9199207 1997 Molecular cloning of a 1alpha,25-dihydroxyvitamin D3-inducible transcript (DDVit 1) in human blood monocytes.