Property Summary

NCBI Gene PubMed Count 33
PubMed Score 51.77
PubTator Score 35.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 2.0e-04
astrocytic glioma -1.600 9.6e-03
atypical teratoid / rhabdoid tumor -1.500 2.2e-05
ependymoma -1.900 8.9e-03
glioblastoma -1.100 5.8e-03
oligodendroglioma -1.700 1.8e-02
ovarian cancer 1.700 5.5e-04
Pick disease -1.600 2.7e-03

Protein-protein Interaction (1)

PDB (12)

Gene RIF (13)

AA Sequence

MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECG      1 - 70
PKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG     71 - 140
QTYNN                                                                     141 - 145
//

Text Mined References (37)

PMID Year Title