Property Summary

NCBI Gene PubMed Count 21
PubMed Score 14.74
PubTator Score 11.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytic glioma -1.700 1.2e-03
ependymoma -1.200 9.9e-03
oligodendroglioma -1.200 1.7e-02
group 3 medulloblastoma 2.100 1.0e-03
medulloblastoma, large-cell 1.600 2.8e-03
primitive neuroectodermal tumor 1.100 3.5e-02
Atopic dermatitis 1.100 2.4e-03
adrenocortical carcinoma 2.760 7.1e-06
non-small cell lung cancer 3.275 2.5e-35
intraductal papillary-mucinous carcinoma... 1.200 2.0e-03
intraductal papillary-mucinous neoplasm ... 1.500 1.7e-03
pancreatic cancer 1.500 6.2e-06
breast carcinoma 2.300 9.8e-48
lung adenocarcinoma 2.200 1.2e-12
pilocytic astrocytoma -1.400 2.6e-06
psoriasis 1.500 1.2e-10
nasopharyngeal carcinoma 1.400 1.6e-03
Endometriosis 1.290 2.7e-02
Breast cancer 3.000 3.7e-11
lung carcinoma 1.200 2.0e-14
Alzheimer's disease -1.100 3.7e-02
Pick disease -1.200 1.4e-03
ductal carcinoma in situ 2.500 2.3e-03
invasive ductal carcinoma 3.600 7.2e-05
ovarian cancer 1.400 3.3e-04
pituitary cancer 1.700 1.3e-06

Protein-protein Interaction (8)

Gene RIF (10)

PMID Text
26308072 Identify critical roles of UBE2T in prostate cancer development and progression.
26119737 UBE2T is the primary E2 of the FA pathway required for FANCD2 and FANCI activation.
26085575 we identified UBE2T as a bona fide FA gene (FANCT) that also may be a rare cancer susceptibility gene.
26046368 Mutations in the gene encoding the E2 conjugating enzyme UBE2T cause Fanconi anemia
21722982 hypoxic conditions down-regulate UBE2T expression which correlates with an increased sensitivity to crosslinking agents consistent with a defective Fanconi anemia pathway
19887602 Our data imply a critical role of UBE2T in development and/or progression of breast cancer through the interaction with and the regulation of the BRCA1/BARD1 complex.
19589784 Upon the occurrence of DNA damage, FANCI becomes monoubiquitinated on Lys-523 by the UBE2T-FANCL pair.
19111657 This work therefore establishes a system that provides mechanistic insight into the functions of FANCL and FANCI in the catalysis of FANCD2 monoubiquitination.
18667844 UBE2T was significantly upregulated in lung cancer tissue and cell lines, suggesting involvement of UBE2T in the malignant cell phenotype.
16916645 UBE2T is the ubiquitin-conjugating enzyme (E2) in the Fanconi anemia pathway and has a self-inactivation mechanism that could be important for negative regulation of the Fanconi anemia pathway.

AA Sequence

MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF      1 - 70
LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFL     71 - 140
KNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV                 141 - 197
//

Text Mined References (25)

PMID Year Title
26308072 2015 Elevated expression of UBE2T exhibits oncogenic properties in human prostate cancer.
26119737 2015 Deficiency of UBE2T, the E2 Ubiquitin Ligase Necessary for FANCD2 and FANCI Ubiquitination, Causes FA-T Subtype of Fanconi Anemia.
26085575 2015 AluY-mediated germline deletion, duplication and somatic stem cell reversion in UBE2T defines a new subtype of Fanconi anemia.
26046368 2015 Mutations in the gene encoding the E2 conjugating enzyme UBE2T cause Fanconi anemia.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23535733 2013 Genome-wide association studies identify four ER negative-specific breast cancer risk loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21775430 2011 Structural analysis of human FANCL, the E3 ligase in the Fanconi anemia pathway.
21722982 2011 Hypoxia disrupts the Fanconi anemia pathway and sensitizes cells to chemotherapy through regulation of UBE2T.
21269460 2011 Initial characterization of the human central proteome.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19887602 2009 Ubiquitination and downregulation of BRCA1 by ubiquitin-conjugating enzyme E2T overexpression in human breast cancer cells.
19589784 2009 FANCI binds branched DNA and is monoubiquitinated by UBE2T-FANCL.
19111657 2008 Mechanistic insight into site-restricted monoubiquitination of FANCD2 by Ube2t, FANCL, and FANCI.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18667844 2008 Elevated expression of UBE2T in lung cancer tumors and cell lines.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17938197 2007 UBE2T, the Fanconi anemia core complex, and FANCD2 are recruited independently to chromatin: a basis for the regulation of FANCD2 monoubiquitination.
16916645 2006 UBE2T is the E2 in the Fanconi anemia pathway and undergoes negative autoregulation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.