Property Summary

NCBI Gene PubMed Count 23
PubMed Score 158.31
PubTator Score 24.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 6.9e-32

Gene RIF (14)

AA Sequence

MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDF      1 - 70
PASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLEN     71 - 140
YEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAK    141 - 210
KKTDKKRALRRL                                                              211 - 222
//

Text Mined References (32)

PMID Year Title