Property Summary

NCBI Gene PubMed Count 32
PubMed Score 12.77
PubTator Score 21.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.003 5.2e-03
esophageal adenocarcinoma 1.100 2.0e-02
psoriasis 1.600 3.4e-113
cutaneous lupus erythematosus 2.200 6.5e-05
osteosarcoma -1.096 1.8e-02
medulloblastoma, large-cell -1.600 7.0e-04
juvenile dermatomyositis 2.896 5.2e-18
tuberculosis 1.900 6.1e-06
lung cancer -2.300 6.1e-06
active Crohn's disease 2.319 1.3e-03
ulcerative colitis 2.200 2.9e-09
Multiple Sclerosis 1.500 1.5e-02
interstitial cystitis 1.200 4.4e-03
invasive ductal carcinoma 1.200 6.8e-03
ovarian cancer 2.100 1.5e-04
dermatomyositis 1.900 7.8e-03

Gene RIF (6)

PMID Text
26506425 Data indicate that reduced expression of the ubiquitin-conjugating enzyme UbcH8 protein correlated with poor outcome in nasopharyngeal carcinoma (NPC) patients.
21628527 study reports that UBCH8 and UBE2G1 and UBE2G2 cooperate with CRL4Cdt2 in promoting the polyubiquitylation and subsequent degradation of p21 and Cdt1, respectively
20508617 gain and loss-of-function approaches show that UBCH8 and the ubiquitin-ligase SIAH1 physically interact with and target FLT3-ITD for proteasomal degradation
19928833 The structure of UbcH8 does not undergo a significant conformational change upon forming a complex with ubiquitin.
18583345 Ube1L was required for transfer of ISG15 to UbcH8 and for binding of Ube1L to UbcH8
15670748 Quantitative-PCR and Northern analysis confirmed down-regulation of UCRP and UBE2L6 with BRCA2 knockdown, respectively.

AA Sequence

MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKF      1 - 70
TTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNA     71 - 140
EEFTLRFGVDRPS                                                             141 - 153
//

Text Mined References (37)

PMID Year Title
26506425 2015 Epigenetic downregulation of the ISG15-conjugating enzyme UbcH8 impairs lipolysis and correlates with poor prognosis in nasopharyngeal carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24446487 2014 E2~Ub conjugates regulate the kinase activity of Shigella effector OspG during pathogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21628527 2011 Selective ubiquitylation of p21 and Cdt1 by UBCH8 and UBE2G ubiquitin-conjugating enzymes via the CRL4Cdt2 ubiquitin ligase complex.
21269460 2011 Initial characterization of the human central proteome.
20508617 2010 Ubiquitin conjugase UBCH8 targets active FMS-like tyrosine kinase 3 for proteasomal degradation.
19928833 2009 The structure of the UbcH8-ubiquitin complex shows a unique ubiquitin interaction site.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
18583345 2008 The basis for selective E1-E2 interactions in the ISG15 conjugation system.
18057259 2008 Negative feedback regulation of RIG-I-mediated antiviral signaling by interferon-induced ISG15 conjugation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16709802 2006 NK lytic-associated molecule, involved in NK cytotoxic function, is an E3 ligase.
16583136 2006 The Spen homolog Msx2-interacting nuclear target protein interacts with the E2 ubiquitin-conjugating enzyme UbcH8.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16428300 2005 Link between the ubiquitin conjugation system and the ISG15 conjugation system: ISG15 conjugation to the UbcH6 ubiquitin E2 enzyme.
16427630 2006 The p53-inducible E3 ubiquitin ligase p53RFP induces p53-dependent apoptosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15670748 2005 Down-regulation of UCRP and UBE2L6 in BRCA2 knocked-down human breast cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485925 2004 Interferon-inducible ubiquitin E2, Ubc8, is a conjugating enzyme for protein ISGylation.
15131269 2004 The UbcH8 ubiquitin E2 enzyme is also the E2 enzyme for ISG15, an IFN-alpha/beta-induced ubiquitin-like protein.
15107846 2004 Triad3A, an E3 ubiquitin-protein ligase regulating Toll-like receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12121982 2002 Staring, a novel E3 ubiquitin-protein ligase that targets syntaxin 1 for degradation.
12075357 2002 Efp targets 14-3-3 sigma for proteolysis and promotes breast tumour growth.
11786535 2002 Regulation of synaptophysin degradation by mammalian homologues of seven in absentia.
11237715 2001 A novel centrosomal ring-finger protein, dorfin, mediates ubiquitin ligase activity.
11078524 2000 Parkin functions as an E2-dependent ubiquitin- protein ligase and promotes the degradation of the synaptic vesicle-associated protein, CDCrel-1.
10894956 2000 Genomic organization of the human ubiquitin-conjugating enzyme gene, UBE2L6 on chromosome 11q12.
10866800 2000 Proteome analysis reveals ubiquitin-conjugating enzymes to be a new family of interferon-alpha-regulated genes.
10558980 1999 Structure of an E6AP-UbcH7 complex: insights into ubiquitination by the E2-E3 enzyme cascade.
10521492 1999 The ubiquitin-conjugating enzymes UbcH7 and UbcH8 interact with RING finger/IBR motif-containing domains of HHARI and H7-AP1.
10085091 1999 Cloning and characterization of human prostate coactivator ARA54, a novel protein that associates with the androgen receptor.
9153201 1997 Physical interaction between specific E2 and Hect E3 enzymes determines functional cooperativity.