Property Summary

NCBI Gene PubMed Count 36
PubMed Score 139.42
PubTator Score 187.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.086 2.9e-05
adult high grade glioma -1.300 1.6e-03
astrocytic glioma -1.400 2.0e-02
atypical teratoid / rhabdoid tumor -1.200 2.3e-04
ependymoma -1.400 3.7e-02
glioblastoma -1.400 2.9e-08
lung cancer 1.500 8.0e-04
Multiple myeloma 1.032 3.8e-03
ovarian cancer -1.200 1.1e-03
subependymal giant cell astrocytoma -1.246 1.0e-02

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNP      1 - 70
PKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEM     71 - 140
FKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATELLLSN              141 - 200
//

Text Mined References (47)

PMID Year Title