Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.61
PubTator Score 2.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
adult high grade glioma 2148 1.3e-04
ovarian cancer 8491 2.4e-04
group 3 medulloblastoma 2254 1.4e-03

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 1.3e-04
group 3 medulloblastoma 1.100 1.4e-03
ovarian cancer 1.400 2.4e-04

Gene RIF (2)

PMID Text
25083800 Endoplasmic reticulum localization and cis-enzymatic activity play a role in regulating the steady state expression of human Ube2J2, ER localization and cis-enzymatic activity play a role in regulating the steady state expression of human Ube2J2.
20061386 analysis of involvement of E2 enzymes in specifying polyubiquitin chain assembly

AA Sequence

MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGYYHGKLIFPRE      1 - 70
FPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDFTKR     71 - 140
QLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAP    141 - 210
GAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVKYVLRSIAQE                         211 - 259
//

Text Mined References (13)

PMID Year Title
25083800 2014 The human ubiquitin conjugating enzyme UBE2J2 (Ubc6) is a substrate for proteasomal degradation.
24807418 2014 A high-coverage shRNA screen identifies TMEM129 as an E3 ligase involved in ER-associated protein degradation.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24019521 2013 RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278356 2001 Endoplasmic reticulum (ER)-associated degradation of T cell receptor subunits. Involvement of ER-associated ubiquitin-conjugating enzymes (E2s).
8393731 1993 Multiple ubiquitin-conjugating enzymes participate in the in vivo degradation of the yeast MAT alpha 2 repressor.