Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.88
PubTator Score 13.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Rheumatoid Arthritis 2.000 3.6e-02
nephrosclerosis 1.109 1.1e-03
Multiple myeloma 1.304 3.8e-02
psoriasis -1.200 2.7e-04
glioblastoma 2.200 2.0e-07
osteosarcoma -2.068 1.3e-07
ependymoma 1.700 5.6e-14
medulloblastoma 1.900 1.2e-08
atypical teratoid / rhabdoid tumor 1.900 2.2e-09
medulloblastoma, large-cell 1.900 3.2e-05
primitive neuroectodermal tumor 1.400 2.8e-05
primary pancreatic ductal adenocarcinoma -1.147 6.6e-03
tuberculosis and treatment for 6 months 1.300 3.7e-05
intraductal papillary-mucinous neoplasm ... -1.300 8.2e-03
active Crohn's disease 1.061 3.2e-02
Breast cancer 3.100 2.2e-02
interstitial cystitis 1.900 2.0e-04
pediatric high grade glioma 1.900 5.5e-08
pilocytic astrocytoma 1.300 3.8e-06
primary Sjogren syndrome 1.200 1.7e-05
ulcerative colitis 1.100 5.0e-05
ovarian cancer 2.100 2.2e-05
Down syndrome 1.200 1.0e-04
pancreatic cancer -1.100 3.5e-03
dermatomyositis 1.300 5.0e-04

Protein-protein Interaction (1)

Gene RIF (3)

PMID Text
21245296 data support a physiological role for HRD1 and UBE2J1 in the homeostatic regulation of MHC class I assembly and expression
20222955 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
16720581 Ubc6e is phosphorylated in response to endoplasmic reticulum stress

AA Sequence

METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPM      1 - 70
KPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRAL     71 - 140
AKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDL    141 - 210
QDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDN    211 - 280
HTDHGGSAVLIVILTLALAALIFRRIYLANEYIFDFEL                                    281 - 318
//

Text Mined References (24)

PMID Year Title
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019521 2013 RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22607976 2012 STT3B-dependent posttranslational N-glycosylation as a surveillance system for secretory protein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21245296 2011 HRD1 and UBE2J1 target misfolded MHC class I heavy chains for endoplasmic reticulum-associated degradation.
20222955 2010 A meta-analysis of genome-wide data from five European isolates reveals an association of COL22A1, SYT1, and GABRR2 with serum creatinine level.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16720581 2006 Human homologs of Ubc6p ubiquitin-conjugating enzyme and phosphorylation of HsUbc6e in response to endoplasmic reticulum stress.
15861135 2005 TNF-alpha induced c-IAP1/TRAF2 complex translocation to a Ubc6-containing compartment and TRAF2 ubiquitination.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12082160 2002 A role for mammalian Ubc6 homologues in ER-associated protein degradation.
11439185 2001 An unfolded putative transmembrane polypeptide, which can lead to endoplasmic reticulum stress, is a substrate of Parkin.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
10708578 2000 Identification of a family of noncanonical ubiquitin-conjugating enzymes structurally related to yeast UBC6.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.