Property Summary

NCBI Gene PubMed Count 231
PubMed Score 267.11
PubTator Score 257.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 7.0e-06
Breast cancer -1.100 9.9e-06
glioblastoma 1.400 2.3e-02
group 3 medulloblastoma 1.300 1.2e-03
invasive ductal carcinoma -1.195 1.0e-03
lung cancer -1.300 4.2e-02
medulloblastoma, large-cell -1.200 1.0e-02
Multiple myeloma 1.156 6.3e-04
non-small cell lung cancer -1.236 4.9e-16
osteosarcoma -2.572 1.4e-03
ovarian cancer -2.700 6.7e-10
pituitary cancer -1.100 2.5e-05
psoriasis -1.600 2.2e-09
tuberculosis and treatment for 6 months 1.100 1.1e-04
Waldenstrons macroglobulinemia 1.143 2.8e-03

Protein-protein Interaction (8)

PDB (28)

Gene RIF (109)

AA Sequence

MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPS      1 - 70
SPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQN     71 - 140
RVEYEKRVRAQAKKFAPS                                                        141 - 158
//

Text Mined References (251)

PMID Year Title