Property Summary

NCBI Gene PubMed Count 31
PubMed Score 12.73
PubTator Score 36.87

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.096 8.0e-03
psoriasis -1.100 4.7e-04
osteosarcoma -2.004 1.7e-06
astrocytoma 1.100 6.3e-03
glioblastoma 1.100 1.4e-02
medulloblastoma, large-cell 1.300 3.5e-06
group 3 medulloblastoma 1.200 5.3e-03
acute myeloid leukemia 1.400 8.4e-03
ovarian cancer 1.700 7.0e-06

Protein-protein Interaction (5)

Gene RIF (7)

PMID Text
24366945 These results reveal an unanticipated mode of Ube2g2 self-association that allows Ube2g2 to effectively engage two ubiquitins to specifically synthesize Lys48-linked ubiquitin chains.
21127063 The presence of the AUP1-Ube2g2 complex at LDs provides a direct molecular link between LDs and the cellular ubiquitination machinery.
21098018 Lys-48-linked polyubiquitin chains may be designed to bind certain proteins like Ube2g2 such that the terminal ubiquitin subunit carrying the reactive Lys-48 side chain can be positioned properly for chain elongation regardless of chain length.
20014027 Results report the solution structure and backbone dynamics of Ube2g2 solved by nuclear magnetic resonance spectroscopy.
16582478 Structural comparison of human UBE2G2 with yeast Ubc7 indicated that the overall structures are similar except for the long loop region and the C-terminal helix.
16407162 interrupting a specific E2-E3 interaction can selectively inhibit endoplasmic reticulum -associated degradation
12869571 Ubc7 mediates inositol 1,4,5-trisphosphate receptor ubiquitination and is a component of the endoplasmic reticulum-associated degradation pathway

AA Sequence

MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPK      1 - 70
MRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDA     71 - 140
SKMWRDDREQFYKIAKQIVQKSLGL                                                 141 - 165
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
24882218 2014 Unanchored K48-linked polyubiquitin synthesized by the E3-ubiquitin ligase TRIM6 stimulates the interferon-IKK? kinase-mediated antiviral response.
24366945 2014 Dimeric Ube2g2 simultaneously engages donor and acceptor ubiquitins to form Lys48-linked ubiquitin chains.
23942235 2013 Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine.
22607976 2012 STT3B-dependent posttranslational N-glycosylation as a surveillance system for secretory protein.
21628527 2011 Selective ubiquitylation of p21 and Cdt1 by UBCH8 and UBE2G ubiquitin-conjugating enzymes via the CRL4Cdt2 ubiquitin ligase complex.
21269460 2011 Initial characterization of the human central proteome.
21127063 2011 Ancient ubiquitous protein 1 (AUP1) localizes to lipid droplets and binds the E2 ubiquitin conjugase G2 (Ube2g2) via its G2 binding region.
21098018 2011 Mechanism of polyubiquitin chain recognition by the human ubiquitin conjugating enzyme Ube2g2.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
20014027 2010 Solution structure and dynamics of human ubiquitin conjugating enzyme Ube2g2.
17681147 2007 Ufd1 is a cofactor of gp78 and plays a key role in cholesterol metabolism by regulating the stability of HMG-CoA reductase.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16582478 2006 Structure of human ubiquitin-conjugating enzyme E2 G2 (UBE2G2/UBC7).
16407162 2006 The activity of a human endoplasmic reticulum-associated degradation E3, gp78, requires its Cue domain, RING finger, and an E2-binding site.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12869571 2003 Inositol 1,4,5-trisphosphate receptor ubiquitination is mediated by mammalian Ubc7, a component of the endoplasmic reticulum-associated degradation pathway, and is inhibited by chelation of intracellular Zn2+.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11724934 2001 The tumor autocrine motility factor receptor, gp78, is a ubiquitin protein ligase implicated in degradation from the endoplasmic reticulum.
11278356 2001 Endoplasmic reticulum (ER)-associated degradation of T cell receptor subunits. Involvement of ER-associated ubiquitin-conjugating enzymes (E2s).
11032556 2000 Biochemistry. Ubiquitination--more than two to tango.
10991948 2000 Ubiquitin-mediated proteolysis of a short-lived regulatory protein depends on its cellular localization.
10830953 2000 The DNA sequence of human chromosome 21.
10558980 1999 Structure of an E6AP-UbcH7 complex: insights into ubiquitination by the E2-E3 enzyme cascade.
10521492 1999 The ubiquitin-conjugating enzymes UbcH7 and UbcH8 interact with RING finger/IBR motif-containing domains of HHARI and H7-AP1.
9925943 1998 Assignment1 of the ubiquitin conjugating enzyme gene, UBE2G2, to human chromosome band 21q22.3 by in situ hybridization.
9693041 1998 Identification, expression, and chromosomal localization of ubiquitin conjugating enzyme 7 (UBE2G2), a human homologue of the Saccharomyces cerevisiae ubc7 gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8393731 1993 Multiple ubiquitin-conjugating enzymes participate in the in vivo degradation of the yeast MAT alpha 2 repressor.