Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.55
PubTator Score 3.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 2.167 8.2e-04
esophageal adenocarcinoma -1.900 1.8e-02
psoriasis 1.900 7.0e-05
atypical teratoid / rhabdoid tumor 1.200 3.0e-06
pancreatic ductal adenocarcinoma liver m... -1.701 6.4e-03
tuberculosis and treatment for 6 months 1.200 1.9e-05
lung cancer 1.500 1.5e-03
Breast cancer 2.100 4.7e-02
adult high grade glioma -1.300 2.1e-04
group 3 medulloblastoma 1.400 3.9e-04
non primary Sjogren syndrome sicca 1.100 2.5e-02
spina bifida -1.327 4.4e-02
ovarian cancer 2.100 2.8e-04

Protein-protein Interaction (4)

Gene RIF (3)

PMID Text
25471371 ubiquitin binding by the acidic loops of Ube2g1 and Ube2r1 enzymes distinguishes their Lys-48-ubiquitylation activities
21628527 study reports that UBCH8 and UBE2G1 and UBE2G2 cooperate with CRL4Cdt2 in promoting the polyubiquitylation and subsequent degradation of p21 and Cdt1, respectively
12933904 In endoplasmic reticulum, involved in the degradation of type 2 iodothyronine selenodeiodinase

AA Sequence

MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPP      1 - 70
KMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVD     71 - 140
AAKEWREDRNGEFKRKVARCVRKSQETAFE                                            141 - 170
//

Text Mined References (23)

PMID Year Title
25471371 2015 Differential ubiquitin binding by the acidic loops of Ube2g1 and Ube2r1 enzymes distinguishes their Lys-48-ubiquitylation activities.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21628527 2011 Selective ubiquitylation of p21 and Cdt1 by UBCH8 and UBE2G ubiquitin-conjugating enzymes via the CRL4Cdt2 ubiquitin ligase complex.
21269460 2011 Initial characterization of the human central proteome.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19103148 2009 CYP3A4 ubiquitination by gp78 (the tumor autocrine motility factor receptor, AMFR) and CHIP E3 ligases.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15673284 2005 TEB4 is a C4HC3 RING finger-containing ubiquitin ligase of the endoplasmic reticulum.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14593114 2004 Human HRD1 is an E3 ubiquitin ligase involved in degradation of proteins from the endoplasmic reticulum.
12933904 2003 Endoplasmic reticulum-associated degradation of the human type 2 iodothyronine deiodinase (D2) is mediated via an association between mammalian UBC7 and the carboxyl region of D2.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11439185 2001 An unfolded putative transmembrane polypeptide, which can lead to endoplasmic reticulum stress, is a substrate of Parkin.
11278356 2001 Endoplasmic reticulum (ER)-associated degradation of T cell receptor subunits. Involvement of ER-associated ubiquitin-conjugating enzymes (E2s).
11032556 2000 Biochemistry. Ubiquitination--more than two to tango.
10558980 1999 Structure of an E6AP-UbcH7 complex: insights into ubiquitination by the E2-E3 enzyme cascade.
10521492 1999 The ubiquitin-conjugating enzymes UbcH7 and UbcH8 interact with RING finger/IBR motif-containing domains of HHARI and H7-AP1.
9693041 1998 Identification, expression, and chromosomal localization of ubiquitin conjugating enzyme 7 (UBE2G2), a human homologue of the Saccharomyces cerevisiae ubc7 gene.
8893823 1996 Molecular cloning of UBE2G, encoding a human skeletal muscle-specific ubiquitin-conjugating enzyme homologous to UBC7 of C. elegans.
8393731 1993 Multiple ubiquitin-conjugating enzymes participate in the in vivo degradation of the yeast MAT alpha 2 repressor.