Property Summary

NCBI Gene PubMed Count 29
PubMed Score 21.27
PubTator Score 15.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.300 2.5e-02
ependymoma -1.300 1.8e-04
group 4 medulloblastoma -2.300 2.4e-04
atypical teratoid / rhabdoid tumor -2.200 2.0e-05
glioblastoma -1.200 4.4e-04
medulloblastoma, large-cell -1.600 9.6e-03
primitive neuroectodermal tumor -1.400 1.2e-02
acute quadriplegic myopathy 1.712 4.5e-08
primary pancreatic ductal adenocarcinoma 1.536 1.9e-03
tuberculosis 1.100 4.5e-07
intraductal papillary-mucinous adenoma (... -1.900 6.5e-05
intraductal papillary-mucinous carcinoma... -2.000 7.8e-04
intraductal papillary-mucinous neoplasm ... -1.400 3.2e-02
Breast cancer -1.300 2.9e-04
invasive ductal carcinoma -1.100 3.4e-02
acute myeloid leukemia 2.200 4.5e-02
ulcerative colitis 1.100 6.8e-03
ovarian cancer 1.900 3.2e-04
pituitary cancer -1.600 1.2e-03
pancreatic cancer 1.300 1.5e-03

 IMPC Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (10)

PMID Text
26020062 rs7612463 UBE2E2 single nucleotide polymorphism is associated with type 2 diabetes mellitus in a Chinese Han population.
25337779 Study found lack of association between UBE2E2 gene polymorphism (rs7612463) and type 2 diabetes mellitus in a Saudi population
23862583 The genetic variants of UBE2E2 are associated with gestational diabetes mellitus and fasting blood glucose.
20818381 Single nucleotide polymorphism in UBE2E2 is associated with type 2 diabetes.
20818381 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)
15545318 Ubiquitin charging can function as a nuclear import trigger, and identify a novel link between E2 regulation and karyopherin-mediated transport.
15485925 Ubc8 is a major ISG15-conjugating enzyme responsible for protein ISGylation upon interferon stimulation
11786535 Siah proteins function as E3 ubiquitin-protein ligases

AA Sequence

MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLD      1 - 70
PPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICL     71 - 140
DILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT             141 - 201
//

Text Mined References (38)

PMID Year Title
26020062 2015 Association between UBE2E2 variant rs7612463 and type 2 diabetes mellitus in a Chinese Han population.
25416956 2014 A proteome-scale map of the human interactome network.
25337779 2014 Lack of association between UBE2E2 gene polymorphism (rs7612463) and type 2 diabetes mellitus in a Saudi population.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24446487 2014 E2~Ub conjugates regulate the kinase activity of Shigella effector OspG during pathogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24132900 2013 Genome-wide association study of atypical psychosis.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
23862583 2013 Putative association between UBE2E2 polymorphisms and the risk of gestational diabetes mellitus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21628527 2011 Selective ubiquitylation of p21 and Cdt1 by UBCH8 and UBE2G ubiquitin-conjugating enzymes via the CRL4Cdt2 ubiquitin ligase complex.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20818381 2010 A genome-wide association study in the Japanese population identifies susceptibility loci for type 2 diabetes at UBE2E2 and C2CD4A-C2CD4B.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20133869 2010 ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16428300 2005 Link between the ubiquitin conjugation system and the ISG15 conjugation system: ISG15 conjugation to the UbcH6 ubiquitin E2 enzyme.
15545318 2004 Ubiquitin charging of human class III ubiquitin-conjugating enzymes triggers their nuclear import.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485925 2004 Interferon-inducible ubiquitin E2, Ubc8, is a conjugating enzyme for protein ISGylation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11786535 2002 Regulation of synaptophysin degradation by mammalian homologues of seven in absentia.
11322894 2001 N-Terminally extended human ubiquitin-conjugating enzymes (E2s) mediate the ubiquitination of RING-finger proteins, ARA54 and RNF8.
11274149 2001 Interaction of the ring finger-related U-box motif of a nuclear dot protein with ubiquitin-conjugating enzymes.
11237715 2001 A novel centrosomal ring-finger protein, dorfin, mediates ubiquitin ligase activity.
10521492 1999 The ubiquitin-conjugating enzymes UbcH7 and UbcH8 interact with RING finger/IBR motif-containing domains of HHARI and H7-AP1.
9371400 1997 cDNA cloning, characterization, and chromosome mapping of UBE2E2 encoding a human ubiquitin-conjugating E2 enzyme.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7757816 1995 [IMAGE: molecular integration of the analysis of the human genome and its expression].