Property Summary

NCBI Gene PubMed Count 54
PubMed Score 18.03
PubTator Score 24.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (17)

PMID Text
26502057 Data show that ubiquitin E2 enzymes UBE2D1/2/3 and E3 ligase RNF138 accumulate at DNA-damage sites and act at early resection stages by promoting CtIP protein ubiquitylation and accrual.
24446487 UbcH5c~Ubiqitin binding stabilizes an active conformation of the Shigella flexneri OspG kinase, greatly enhancing its activity.
24403071 These data reveal novel insights into the Otub1 inhibition of E2 wherein monoubiquitination promotes the interaction of Otub1 with UbcH5 and the function to suppress it.
24296361 This study demonistrated by Gene expression profile that UBE3D3 upregulaion in fibroblasts of Huntington's disease patients.
23741361 UBE2D3 participates in the process of radiosensitivity in human breast cancer cells by regulating TERT and cyclin D1.
23550736 although a reduction in interdomain dynamics of UbcH5c~Ub is observed upon binding to E4B, Ub retains an extensive degree of flexibility
21772249 The crystal structure of a complex of the Bmi1/Ring1b RING-RING heterodimer & UbcH5c shows that UbcH5c interacts with Ring1b only.
21226485 UbcH5c approximately Ub conjugate populates an array of extended conformations, and the population of Ubc13 approximately Ub conjugates favors a closed conformation in which the hydrophobic surface of Ub faces helix 2 of Ubc13
20860768 Observational study of gene-disease association. (HuGE Navigator)
20696396 determined structures of E4B U box free and bound to UbcH5c and Ubc4 E2s; findings show E4B U box is a monomer stabilized by a network of hydrogen bonds; findings suggest allosteric regulation of UbcH5c and Ubc4 by E4B U box
20347421 Combined Actions of UbcH5c and Cdc34 Promote Rapid and Efficient Polyubiquitination of IkBa
20332099 Observational study of gene-disease association. (HuGE Navigator)
20051513 role of WW3 and WW4 domains of Nedd4-2 in dopamine transporter ubiquitination was demonstrated; siRNA analysis demonstrated that this polyubiquitination is mediated by Nedd4-2 cooperation with UBE2D and UBE2L3 E2 ubiquitin-conjugating enzymes
18515077 These results suggest that UbcH5 regulates ZIPK accumulation in PML-NBs by interacting with ZIPK and stimulating its ubiquitination.
17420285 Knocking down UBE2D3 by RNA interference leads to blockage oof retinoic acid induced chclin D1 degradation and cell cycle arrest.
15280377 UbcH5B/C are E2s for Mdm2, which contribute to the maintenance of low levels of p53 and Mdm2 in unstressed cells; inhibition of p53 ubiquitination and degradation by targeting UbcH5B/C is not sufficient to up-regulate p53 transcriptional activity.
12215439 Transducin beta-gamma is a substrate of UbcH5c (UBE2D3), UbcH7 (UBE2L3) and the ubiquitin-proteasome pathway only following the dissociation of transducin alpha from beta-gamma. Transducin beta-gamma is protected from ubiquitylation by phosducin.

AA Sequence

MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT      1 - 70
TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (68)

PMID Year Title
26752685 2016 FIH Regulates Cellular Metabolism through Hydroxylation of the Deubiquitinase OTUB1.
26502057 2015 Systematic E2 screening reveals a UBE2D-RNF138-CtIP axis promoting DNA repair.
25416956 2014 A proteome-scale map of the human interactome network.
24446487 2014 E2~Ub conjugates regulate the kinase activity of Shigella effector OspG during pathogenesis.
24403071 2014 Monoubiquitination is critical for ovarian tumor domain-containing ubiquitin aldehyde binding protein 1 (Otub1) to suppress UbcH5 enzyme and stabilize p53 protein.
24296361 2014 Gene expression profile in fibroblasts of Huntington's disease patients and controls.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23741361 2013 Inhibition of UBE2D3 expression attenuates radiosensitivity of MCF-7 human breast cancer cells by increasing hTERT expression and activity.
23550736 2013 Activation of UbcH5c~Ub is the result of a shift in interdomain motions of the conjugate bound to U-box E3 ligase E4B.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22124327 2012 Positive regulation of p53 stability and activity by the deubiquitinating enzyme Otubain 1.
21772249 2011 Recognition of UbcH5c and the nucleosome by the Bmi1/Ring1b ubiquitin ligase complex.
21685362 2011 The IDOL-UBE2D complex mediates sterol-dependent degradation of the LDL receptor.
21532592 2011 UBCH7 reactivity profile reveals parkin and HHARI to be RING/HECT hybrids.
21269460 2011 Initial characterization of the human central proteome.
21226485 2011 Ubiquitin in motion: structural studies of the ubiquitin-conjugating enzyme?ubiquitin conjugate.
21068390 2011 Bifunctional apoptosis regulator (BAR), an endoplasmic reticulum (ER)-associated E3 ubiquitin ligase, modulates BI-1 protein stability and function in ER Stress.
20860768 2011 Replication of two novel susceptibility loci for non-syndromic orofacial clefts in a Chinese population.
20696396 2010 Molecular basis for the association of human E4B U box ubiquitin ligase with E2-conjugating enzymes UbcH5c and Ubc4.
20525694 2010 The N terminus of Cbl-c regulates ubiquitin ligase activity by modulating affinity for the ubiquitin-conjugating enzyme.
20347421 2010 Priming and extending: a UbcH5/Cdc34 E2 handoff mechanism for polyubiquitination on a SCF substrate.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
20133640 2010 Identification of an unconventional E3 binding surface on the UbcH5 ~ Ub conjugate recognized by a pathogenic bacterial E3 ligase.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
20051513 2010 Lysine 63-linked polyubiquitination of the dopamine transporter requires WW3 and WW4 domains of Nedd4-2 and UBE2D ubiquitin-conjugating enzymes.
20017557 2010 Structural and functional characterization of the monomeric U-box domain from E4B.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
18948756 2008 PCNA is ubiquitinated by RNF8.
18851830 2008 Multimodal activation of the ubiquitin ligase SCF by Nedd8 conjugation.
18515077 2008 Physical and functional interactions between ZIP kinase and UbcH5.
18508924 2008 Ubc4/5 and c-Cbl continue to ubiquitinate EGF receptor after internalization to facilitate polyubiquitination and degradation.
18313049 2008 A cancer-associated RING finger protein, RNF43, is a ubiquitin ligase that interacts with a nuclear protein, HAP95.
18284575 2008 Legionella translocates an E3 ubiquitin ligase that has multiple U-boxes with distinct functions.
17588522 2007 E3-independent monoubiquitination of ubiquitin-binding proteins.
17420285 2007 RNAi screen identifies UBE2D3 as a mediator of all-trans retinoic acid-induced cell growth arrest in human acute promyelocytic NB4 cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16628214 2006 A conserved pathway to activate BRCA1-dependent ubiquitylation at DNA damage sites.
16543155 2006 A UbcH5/ubiquitin noncovalent complex is required for processive BRCA1-directed ubiquitination.
16522193 2006 MEX is a testis-specific E3 ubiquitin ligase that promotes death receptor-induced apoptosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15621726 2004 Bone morphogenetic proteins.
15496420 2004 The poxvirus p28 virulence factor is an E3 ubiquitin ligase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280377 2004 Regulation of p53 by the ubiquitin-conjugating enzymes UbcH5B/C in vivo.
15247280 2004 Topors functions as an E3 ubiquitin ligase with specific E2 enzymes and ubiquitinates p53.
14765125 2004 Nrdp1-mediated degradation of the gigantic IAP, BRUCE, is a novel pathway for triggering apoptosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12867425 2003 A role for NF-kappaB essential modifier/IkappaB kinase-gamma (NEMO/IKKgamma) ubiquitination in the activation of the IkappaB kinase complex by tumor necrosis factor-alpha.
12732733 2003 Binding and recognition in the assembly of an active BRCA1/BARD1 ubiquitin-ligase complex.
12670957 2003 The BAL-binding protein BBAP and related Deltex family members exhibit ubiquitin-protein isopeptide ligase activity.
12646252 2003 Mammalian Numb is a target protein of Mdm2, ubiquitin ligase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12215439 2002 Ubiquitylation of the transducin betagamma subunit complex. Regulation by phosducin.
11927591 2002 Autoubiquitination of the BRCA1*BARD1 RING ubiquitin ligase.
11743028 2001 CHIP is a chaperone-dependent E3 ligase that ubiquitylates unfolded protein.
11485561 2001 Polyamine analogues inhibit the ubiquitination of spermidine/spermine N1-acetyltransferase and prevent its targeting to the proteasome for degradation.
10835356 2000 SCF(beta)(-TrCP) ubiquitin ligase-mediated processing of NF-kappaB p105 requires phosphorylation of its C-terminus by IkappaB kinase.
10329681 1999 Identification of the ubiquitin carrier proteins, E2s, involved in signal-induced conjugation and subsequent degradation of IkappaBalpha.
10230407 1999 ROC1, a homolog of APC11, represents a family of cullin partners with an associated ubiquitin ligase activity.
9990509 1998 Human ubiquitin-protein ligase Nedd4: expression, subcellular localization and selective interaction with ubiquitin-conjugating enzymes.
9488723 1998 DNA double-stranded breaks induce histone H2AX phosphorylation on serine 139.
8530467 1995 Identification of a family of closely related human ubiquitin conjugating enzymes.
8090726 1994 Identification of a human ubiquitin-conjugating enzyme that mediates the E6-AP-dependent ubiquitination of p53.