Property Summary

NCBI Gene PubMed Count 63
PubMed Score 111.29
PubTator Score 51.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 6.8e-05
astrocytic glioma -1.300 2.5e-02
atypical teratoid / rhabdoid tumor -1.800 2.3e-05
Breast cancer 2.400 3.1e-02
ependymoma -1.700 2.5e-02
glioblastoma -1.100 1.9e-04
malignant mesothelioma 1.400 3.0e-06
medulloblastoma, large-cell -1.500 7.6e-05
Multiple myeloma 1.438 1.8e-03
osteosarcoma -1.011 1.2e-04
ovarian cancer 1.400 1.1e-03

Protein-protein Interaction (6)

PDB (34)

Gene RIF (21)

AA Sequence

MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT      1 - 70
TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (71)

PMID Year Title