Property Summary

NCBI Gene PubMed Count 67
PubMed Score 446.50
PubTator Score 59.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.167 2.2e-02
acute quadriplegic myopathy -1.082 9.4e-04
aldosterone-producing adenoma -1.378 6.9e-03
cutaneous lupus erythematosus 1.300 1.7e-02
Duchenne muscular dystrophy -1.004 1.2e-04
group 4 medulloblastoma 1.400 5.7e-04
limb girdle muscular dystrophy 2B -1.155 2.3e-04
malignant mesothelioma -1.100 1.4e-04
ovarian cancer -1.200 2.8e-04
sarcoidosis 1.600 1.2e-02

 GWAS Trait (1)

Gene RIF (19)

AA Sequence

MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT      1 - 70
TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (72)

PMID Year Title