Property Summary

NCBI Gene PubMed Count 63
PubMed Score 417.60
PubTator Score 59.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -1.100 1.4e-04
cutaneous lupus erythematosus 1.300 1.7e-02
Duchenne muscular dystrophy -1.004 1.2e-04
limb girdle muscular dystrophy 2B -1.155 2.3e-04
acute quadriplegic myopathy -1.451 2.1e-04
active Crohn's disease 1.167 2.2e-02
sarcoidosis 1.600 1.2e-02
group 4 medulloblastoma 1.400 5.7e-04
aldosterone-producing adenoma -1.378 6.9e-03
ovarian cancer -1.200 2.8e-04

Synonym

Accession P51668 A6NLF6 A8K786
Symbols SFT
UBCH5
UBC4/5
UBCH5A
E2(17)KB1

Gene

PANTHER Protein Class (1)

PDB

2YHO   3OJ4   3PTF   4AP4   2C4P   4QPL   5FER  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (18)

PMID Text
26502057 Data show that ubiquitin E2 enzymes UBE2D1/2/3 and E3 ligase RNF138 accumulate at DNA-damage sites and act at early resection stages by promoting CtIP protein ubiquitylation and accrual.
25543083 The Asp17 mutation in MDM2 stimulated its discharge of the UBCH5a-ubiquitin thioester adduct.
24709419 The SMURF2:UBCH5 complex is critical in maintaining KRAS protein stability.
24211586 Biochemical characterization of recombinant UBTD1 and UBE2D demonstrated that the two proteins form a stable, stoichiometric complex that can be purified to near homogeneity.
22842904 crystal structure of the dimeric RING domain of rat RNF4 in complex with E2 (UbcH5A) linked by an isopeptide bond to ubiquitin
22438555 These data demonstrate that the ability of ICP0 to interact with cellular E2 ubiquitin-conjugating enzyme UBE2D1 is fundamentally important for its biological functions during HSV-1 infection.
21685362 identify the IDOL-UBE2D complex as an important determinant of LDLR activity, and provide insight into molecular mechanisms underlying the regulation of cholesterol uptake
21396940 This structure reveals an interaction between the ubiquitin surface flanking K11 and residues adjacent to the E2 catalytic cysteine and suggests a possible role for this surface in formation of K11 linkages.
21113135 The authors demonstrate that c-IAP1 and UbcH5 family promote K11-linked polyubiquitination of receptor-interacting protein 1 (RIP1) in vitro and in vivo.
20347421 Whereas UbcH5(A, B and C) is highly efficient in converting IkBa into monoubiquitinated forms, Cdc34 drives ubiquitin (Ub)-Ub conjugation
20146531 conformational changes in CHIP upon binding of Hsp70, Hsp90, and their respective C-terminal EEVD peptides, and in complex with the different E2 ubiquitin-conjugating enzymes UbcH5a and Ubc13
19854139 Catalytically active Ubc5 is required for IRF3 activation by viral infection.
18845142 Ro52 has both cytoplasmic and nuclear substrates, and mediates ubiquitination through UBE2D1 in the cytoplasm and through UBE2E1 in the nucleus.
17373700 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
15139022 comparison of the regional distribution of SFT/UbcH5A and DMT1 mRNA in the adult brain
12883554 Ubiquitination of HIV-1 Tat by Hdm2 requires ubiquitin-conjugating enzyme E2D 1 (UbcH5)
12480712 UbcH5A is up-regulated in the liver of iron-overloaded patients with hereditary hemochromatosis, but in vitro studies failed to show regulation in response to iron loading or chelation. Earlier in vivo mRNA expression data for SFT might be UbcH5A.

AA Sequence

MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT      1 - 70
TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (67)

PMID Year Title
26752685 2016 FIH Regulates Cellular Metabolism through Hydroxylation of the Deubiquitinase OTUB1.
26502057 2015 Systematic E2 screening reveals a UBE2D-RNF138-CtIP axis promoting DNA repair.
25543083 2015 Phosphomimetic mutation of the N-terminal lid of MDM2 enhances the polyubiquitination of p53 through stimulation of E2-ubiquitin thioester hydrolysis.
25416956 2014 A proteome-scale map of the human interactome network.
24709419 2014 KRAS protein stability is regulated through SMURF2: UBCH5 complex-mediated ?-TrCP1 degradation.
24211586 2014 The UbL protein UBTD1 stably interacts with the UBE2D family of E2 ubiquitin conjugating enzymes.
23509263 2013 Activity-enhancing mutations in an E3 ubiquitin ligase identified by high-throughput mutagenesis.
22842904 2012 Structure of a RING E3 ligase and ubiquitin-loaded E2 primed for catalysis.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
22438555 2012 Functional characterization of residues required for the herpes simplex virus 1 E3 ubiquitin ligase ICP0 to interact with the cellular E2 ubiquitin-conjugating enzyme UBE2D1 (UbcH5a).
22124327 2012 Positive regulation of p53 stability and activity by the deubiquitinating enzyme Otubain 1.
21685362 2011 The IDOL-UBE2D complex mediates sterol-dependent degradation of the LDL receptor.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21396940 2011 Modulation of K11-linkage formation by variable loop residues within UbcH5A.
21113135 2010 c-IAP1 and UbcH5 promote K11-linked polyubiquitination of RIP1 in TNF signalling.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20347421 2010 Priming and extending: a UbcH5/Cdc34 E2 handoff mechanism for polyubiquitination on a SCF substrate.
20146531 2010 Insights into the conformational dynamics of the E3 ubiquitin ligase CHIP in complex with chaperones and E2 enzymes.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19854139 2009 Key role of Ubc5 and lysine-63 polyubiquitination in viral activation of IRF3.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
19103148 2009 CYP3A4 ubiquitination by gp78 (the tumor autocrine motility factor receptor, AMFR) and CHIP E3 ligases.
18845142 2008 The autoantigen Ro52 is an E3 ligase resident in the cytoplasm but enters the nucleus upon cellular exposure to nitric oxide.
18359941 2008 Members of the E2D (UbcH5) family mediate the ubiquitination of the conserved cysteine of Pex5p, the peroxisomal import receptor.
18042044 2008 Two different classes of E2 ubiquitin-conjugating enzymes are required for the mono-ubiquitination of proteins and elongation by polyubiquitin chains with a specific topology.
17588522 2007 E3-independent monoubiquitination of ubiquitin-binding proteins.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
17318174 2007 Notch inhibits apoptosis by direct interference with XIAP ubiquitination and degradation.
16522193 2006 MEX is a testis-specific E3 ubiquitin ligase that promotes death receptor-induced apoptosis.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16275645 2006 The F-box protein FBX4 targets PIN2/TRF1 for ubiquitin-mediated degradation and regulates telomere maintenance.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15621726 2004 Bone morphogenetic proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247280 2004 Topors functions as an E3 ubiquitin ligase with specific E2 enzymes and ubiquitinates p53.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15139022 2004 Developmental, regional, and cellular expression of SFT/UbcH5A and DMT1 mRNA in brain.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14593737 2003 The mitotic checkpoint: a signaling pathway that allows a single unattached kinetochore to inhibit mitotic exit.
14562029 2003 The RING-H2 protein RNF11 is overexpressed in breast cancer and is a target of Smurf2 E3 ligase.
12883554 2003 A non-proteolytic role for ubiquitin in Tat-mediated transactivation of the HIV-1 promoter.
12670957 2003 The BAL-binding protein BBAP and related Deltex family members exhibit ubiquitin-protein isopeptide ligase activity.
12480712 2003 UbcH5A, a member of human E2 ubiquitin-conjugating enzymes, is closely related to SFT, a stimulator of iron transport, and is up-regulated in hereditary hemochromatosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393902 2002 MdmX is a RING finger ubiquitin ligase capable of synergistically enhancing Mdm2 ubiquitination.
12070128 2002 Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.
11742988 2001 APC/C-mediated destruction of the centrosomal kinase Nek2A occurs in early mitosis and depends upon a cyclin A-type D-box.
11557750 2001 CHIP is a U-box-dependent E3 ubiquitin ligase: identification of Hsc70 as a target for ubiquitylation.
11535616 2001 Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.
11389839 2001 Siah-1, SIP, and Ebi collaborate in a novel pathway for beta-catenin degradation linked to p53 responses.
11340163 2001 A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
11274149 2001 Interaction of the ring finger-related U-box motif of a nuclear dot protein with ubiquitin-conjugating enzymes.
10973499 2000 Activation of HIF1alpha ubiquitination by a reconstituted von Hippel-Lindau (VHL) tumor suppressor complex.
10793135 2000 Mitotic regulation of the APC activator proteins CDC20 and CDH1.
10548110 1999 Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.
10072594 1998 Assignment of UBE2D1 to human chromosome bands 10q11.2-->q21 by in situ hybridization.
10066826 1999 Identification of determinants in E2 ubiquitin-conjugating enzymes required for hect E3 ubiquitin-protein ligase interaction.
9918797 1998 Characterization and chromosomal mapping of the human gene for SFT, a stimulator of Fe transport.
9362508 1997 Functional expression cloning and characterization of SFT, a stimulator of Fe transport.
9182527 1997 Subcellular localization and ubiquitin-conjugating enzyme (E2) interactions of mammalian HECT family ubiquitin protein ligases.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8530467 1995 Identification of a family of closely related human ubiquitin conjugating enzymes.
8090726 1994 Identification of a human ubiquitin-conjugating enzyme that mediates the E6-AP-dependent ubiquitination of p53.