Property Summary

NCBI Gene PubMed Count 73
PubMed Score 85.93
PubTator Score 96.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Gene RIF (49)

PMID Text
26062455 the present study showed that miR-196a promoted cell proliferation by targeting UBE2C in breast cancer. Thus, miR-196a may be a potential oncogene in breast cancer and a promising therapeutic target in breast cancer treatment.
25917796 Study shows an overexpression of UbcH10 mRNA and protein in the vast majority of colorectal cancer (CRC) patients analyzed and indicates that UbcH10 expression regulates CRC growth.
25832867 UBE2C could regulate phospho-ERK1/2 level.
25825779 in addition to binding APC11's RING, UBCH10 is corecruited via interactions with APC2
25760688 Upregulation of miR-17/20a promotes gastric cancer cell growth by targeting UBE2C.
25739083 Data suggest that ubiquitin-conjugating enzyme UbcH10 may be a promising target for the therapy of breast cancer.
25376843 UbcH10 overexpression increases carcinogenesis and blocks ALLN susceptibility in colorectal cancer.
25368385 excess E2F1 due to Rb inactivation recruits the complex of Cdc20 and the anaphase-promoting complex/cyclosome to deregulate the expression of UBCH10
24815438 the UBE2C gene is capable of promoting proliferation and invasion of lung cancer cells. Therefore, UBE2C may play a pivotal role in development and invasion of lung cancer.
24699941 UBE2C may be a marker for diagnosis of nonpalpable breast lesions but not benign or malignant tumors in mammography core biopsies. Suppression of UBE2C may be a potential therapy target in breast cancer.
24512726 Results suggest that UBE2C acts as an oncogene in prostate cancer progression.
24114735 Elevated levels of S100A8 and UBE2C were observed.
24072565 Data suggest that ubiquitin conjugating enzyme UBE2C may serve as a potential therapeutic target aimed at inducing radiation and chemo sensitization.
23826418 UBE2C positivity is independently associated with shorter cancer-specific survival in bladder cancer patients who underwent radical cystectomy.
23357462 Data indicate that expression-based risk indices of three genes UBE2C, TPX2, and MELK were more strongly associated with poor 5-year survival in adenocarcinoma patients.
23355337 High expression of UbcH10 was associated with pancreatic ductal adenocarcinoma.
23201130 the expression of cyclin D1, MCM7, TRIM29, and UBE2C was found to be significantly associated with progression to muscle-invasive bladder cancer.
23102841 UbcH10 overexpression has a critical role in lung carcinogenesis, and the evaluation of UbcH10 expression levels may be a new tool for the characterisation of non small cell lung carcinoma.
22760214 Data sugggest that UbcH10 may play an important role in non-small cell lung cancer (NSCLC) carcinogenesis, and silencing UbcH10 may represent a potential therapeutic strategy for NSCLC.
22694363 growth rate of SiHa and HeLa transfected with dominant negative-UBE2C was significantly reduced compared to vector control
22415060 Overexpression of UbcH10 may be a useful indicator of endometrial carcinoma.
22056852 High UBE2C mRNA expression was found to be of adverse prognostic significance in high-risk breast cancer patients
21651863 Effect of UBE2C overexpression on the proliferation of 293T cell line
21556051 Mediator complex subunit (MED)1 phosphorylation leads to UBE2C locus looping, UBE2C gene expression and cell growth in castration-resistant prostate cancer.
21454660 Spindle assembly checkpoint protein Cdc20 transcriptionally activates expression of ubiquitin carrier protein UbcH10.
21354912 UbcH10 expression was associated with tumor invasion of the portal vein, tumor size, TNM staging, and tumor differentiation in hepatocellular carcinoma.
20739533 elevated levels of Ubch10 and Cdc20 degrade cyclin B in hpv-16 iinfected cells, required for exit from mitosis, permitting initiation of the next round of DNA synthesis and cell cycle progression.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20065091 show that UbcH10 overexpression leads to precocious degradation of cyclin B by the anaphase-promoting complex/cyclosome, supernumerary centrioles, lagging chromosomes, and aneuploidy.
20007692 The unstructured N-terminal region of UbcH10 directly binds the 19 S regulatory complex of the 26 S proteasome, and it mediates the initiation of substrate translocation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19779934 The overexpression of UbcH10 gene plays a critical role in the carcinogenesis and tumor progression of colorectal cancer.
19657671 Data imply that knocking-down UbcH10 protein expression may represent a potential therapeutic option for glioma.
19638491 One of those genes, UBE2C, seems to be a powerful biomarker for NSCLC survival prediction.
19438748 Taken together, these results indicate that UbcH10 is a novel lymphoid proliferation marker encompassing the cell cycle window associated with exit from mitosis
19302711 Results show the clinicopathological significance of UbcH10 in the progression of colon cancer, and thus UbcH10 may act as a novel biomarker in patients with colon cancer.
19038004 Elevated expression of UbcH10 is associated with breast cancer.
18854154 Knockdown of ubiquitin-conjugating enzyme E2C (UBE2C) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18753363 Cyclin D1 and UBCH10 amplicons in anaplastic thyroid carcinoma.
18722180 UbcH10 combines a specific E2-E3 interface and regulation via its N-terminal extension to limit anaphase-promoting complex activity for substrate selection and checkpoint control.
18666437 a clear correlation between UbcH10 expression and the histological grade of the astrocytic tumors.
18559889 The rate-limiting role of UbcH10 is only at the end of G1 phase, just before DNA replication begins.
18331723 These data suggest that overexpression of UbcH10 may serve as one important molecular mechanism that underlies the astrocytic carcinogenesis.
17354233 Ube2c gene appeared to be associated with hepatocellular carcinoma progression
17217624 Transfection of dominant-negative UBE2C into Seg-1 esophageal adenocarcinoma cells decreases proliferation and increased mitotic arrest compared to vector controls.
16772118 results showing aberrations in levels of gene expression and locus copy number of ubiquitin-conjugating enzyme E2C gene (UBE2C) suggest that this gene may play an important role in tumor progression leading to advanced colon cancer with liver metastasis
16106252 UbcH10 overexpression is involved in thyroid cell proliferation and may represent a marker of thyroid anaplastic carcinomas
15208666 UbcH10 plays an important role in tumor development and that its inhibition in combination with agonists of the TRAIL receptor may provide an enhanced therapeutic index
12874022 UbcH10 is highly expressed in various human primary tumors and UbcH10 has an ability to promote cell growth and malignant transformation.

AA Sequence

MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAA      1 - 70
GTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLG     71 - 140
EPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP                                   141 - 179
//

Text Mined References (80)

PMID Year Title
26062455 2015 MicroRNA-196a post-transcriptionally upregulates the UBE2C proto-oncogene and promotes cell proliferation in breast cancer.
25917796 2016 UbcH10 expression can predict prognosis and sensitivity to the antineoplastic treatment for colorectal cancer patients.
25832867 2015 Ubiquitin-conjugating enzyme E2C regulates apoptosis-dependent tumor progression of non-small cell lung cancer via ERK pathway.
25825779 2015 RING E3 mechanism for ubiquitin ligation to a disordered substrate visualized for human anaphase-promoting complex.
25760688 2015 Inhibition of microRNA-17/20a suppresses cell proliferation in gastric cancer by modulating UBE2C expression.
25739083 2015 Knockdown of UbcH10 enhances the chemosensitivity of dual drug resistant breast cancer cells to epirubicin and docetaxel.
25376843 2014 UbcH10 overexpression increases carcinogenesis and blocks ALLN susceptibility in colorectal cancer.
25368385 2015 Deregulation of Rb-E2F1 axis causes chromosomal instability by engaging the transactivation function of Cdc20-anaphase-promoting complex/cyclosome.
24815438 2014 Effects of ubiquitin-conjugating enzyme 2C on invasion, proliferation and cell cycling of lung cancer cells.
24699941 2014 Ubiquitin-conjugating enzyme UBE2C is highly expressed in breast microcalcification lesions.
24512726 2013 Involvement of ubiquitin-conjugating enzyme E2C in proliferation and invasion of prostate carcinoma cells.
24114735 2014 Additive effect of the AZGP1, PIP, S100A8 and UBE2C molecular biomarkers improves outcome prediction in breast carcinoma.
24072565 2013 Inhibition of ubiquitin conjugating enzyme UBE2C reduces proliferation and sensitizes breast cancer cells to radiation, doxorubicin, tamoxifen and letrozole.
23826418 2013 UBE2C is a marker of unfavorable prognosis in bladder cancer after radical cystectomy.
23357462 2013 Network-based approach identified cell cycle genes as predictor of overall survival in lung adenocarcinoma patients.
23355337 2013 Expression of UbcH10 in pancreatic ductal adenocarcinoma and its correlation with prognosis.
23201130 2013 Multicenter validation of cyclin D1, MCM7, TRIM29, and UBE2C as prognostic protein markers in non-muscle-invasive bladder cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23102841 2013 UbcH10 overexpression in human lung carcinomas and its correlation with EGFR and p53 mutational status.
22760214 2012 UbcH10 expression provides a useful tool for the prognosis and treatment of non-small cell lung cancer.
22694363 2012 Dominant negative Ubiquitin-conjugating enzyme E2C sensitizes cervical cancer cells to radiation.
22415060 2012 UbcH10 expression in benign, hyperplastic, and malignant endometrial curetted materials: a tissue microarray study.
22056852 2012 Prognostic significance of UBE2C mRNA expression in high-risk early breast cancer. A Hellenic Cooperative Oncology Group (HeCOG) Study.
21651863 2011 [Effect of UBE2C overexpression on the proliferation of 293T cell line].
21556051 2011 Phospho-MED1-enhanced UBE2C locus looping drives castration-resistant prostate cancer growth.
21454660 2011 Spindle assembly checkpoint protein Cdc20 transcriptionally activates expression of ubiquitin carrier protein UbcH10.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21354912 2011 [UbcH10 expression in hepatocellular carcinoma and its clinicopathological significance].
21269460 2011 Initial characterization of the human central proteome.
20739533 2010 Compromised spindle assembly checkpoint due to altered expression of Ubch10 and Cdc20 in human papillomavirus type 16 E6- and E7-expressing keratinocytes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20065091 2010 Overexpression of the E2 ubiquitin-conjugating enzyme UbcH10 causes chromosome missegregation and tumor formation.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
20007692 2010 Degradation of some polyubiquitinated proteins requires an intrinsic proteasomal binding element in the substrates.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19822757 2009 Identification of a physiological E2 module for the human anaphase-promoting complex.
19820702 2009 UBE2S elongates ubiquitin chains on APC/C substrates to promote mitotic exit.
19779934 2010 Association of clinicopathological features with UbcH10 expression in colorectal cancer.
19657671 2010 Knockdown of ubiquitin-conjugating enzyme E2C/UbcH10 expression by RNA interference inhibits glioma cell proliferation and enhances cell apoptosis in vitro.
19638491 2009 Identification of gene signatures and molecular markers for human lung cancer prognosis using an in vitro lung carcinogenesis system.
19438748 2009 UbcH10 expression in human lymphomas.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19302711 2009 Overexpression of UbcH10 alternates the cell cycle profile and accelerate the tumor proliferation in colon cancer.
19038004 2009 Clinicopathological relevance of UbcH10 in breast cancer.
18753363 2008 Array-CGH identifies cyclin D1 and UBCH10 amplicons in anaplastic thyroid carcinoma.
18722180 2008 The unique N terminus of the UbcH10 E2 enzyme controls the threshold for APC activation and enhances checkpoint regulation of the APC.
18666437 Analysis of UbcH10 expression represents a useful tool for the diagnosis and therapy of astrocytic tumors.
18559889 2008 UbcH10 has a rate-limiting role in G1 phase but might not act in the spindle checkpoint or as part of an autonomous oscillator.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
18331723 2008 Expression of ubiquitin-conjugating enzyme E2C/UbcH10 in astrocytic tumors.
17588522 2007 E3-independent monoubiquitination of ubiquitin-binding proteins.
17443180 2007 Anaphase initiation is regulated by antagonistic ubiquitination and deubiquitination activities.
17354233 2007 Identification of overexpressed genes in hepatocellular carcinoma, with special reference to ubiquitin-conjugating enzyme E2C gene expression.
17217624 2006 Expression and effect of inhibition of the ubiquitin-conjugating enzyme E2C on esophageal adenocarcinoma.
16772118 2006 Detection of aberrations of ubiquitin-conjugating enzyme E2C gene (UBE2C) in advanced colon cancer with liver metastases by DNA microarray and two-color FISH.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
16106252 2005 UbcH10 overexpression may represent a marker of anaplastic thyroid carcinomas.
15558010 2004 Autonomous regulation of the anaphase-promoting complex couples mitosis to S-phase entry.
15504738 2005 Genes affecting the cell cycle, growth, maintenance, and drug sensitivity are preferentially regulated by anti-HER2 antibody through phosphatidylinositol 3-kinase-AKT signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15208666 2004 Overexpression, genomic amplification and therapeutic potential of inhibiting the UbcH10 ubiquitin conjugase in human carcinomas of diverse anatomic origin.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14593737 2003 The mitotic checkpoint: a signaling pathway that allows a single unattached kinetochore to inhibit mitotic exit.
12874022 2003 UbcH10 is the cancer-related E2 ubiquitin-conjugating enzyme.
12629039 2003 The RAG1 N-terminal domain is an E3 ubiquitin ligase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070128 2002 Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.
11927573 2002 Structural and functional analysis of the human mitotic-specific ubiquitin-conjugating enzyme, UbcH10.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11742988 2001 APC/C-mediated destruction of the centrosomal kinase Nek2A occurs in early mitosis and depends upon a cyclin A-type D-box.
11739784 2001 APC2 Cullin protein and APC11 RING protein comprise the minimal ubiquitin ligase module of the anaphase-promoting complex.
11549316 2001 A high-resolution 6.0-megabase transcript map of the type 2 diabetes susceptibility region on human chromosome 20.
11535616 2001 Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.
11340163 2001 A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
10793135 2000 Mitotic regulation of the APC activator proteins CDC20 and CDH1.
10548110 1999 Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.
9122200 1997 Dominant-negative cyclin-selective ubiquitin carrier protein E2-C/UbcH10 blocks cells in metaphase.