Property Summary

NCBI Gene PubMed Count 41
PubMed Score 38.76
PubTator Score 325.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.262 2.8e-03
astrocytic glioma -1.700 1.5e-02
oligodendroglioma -1.400 3.3e-02
psoriasis 1.200 2.9e-04
ependymoma -1.200 1.2e-08
atypical teratoid / rhabdoid tumor -1.900 6.8e-07
glioblastoma -1.400 3.3e-04
medulloblastoma, large-cell -1.900 3.6e-05
primitive neuroectodermal tumor -1.100 5.2e-04
limb girdle muscular dystrophy 2B -1.156 1.3e-06
tuberculosis and treatment for 3 months -1.100 2.0e-06
lung cancer -1.900 3.4e-05
adult high grade glioma -1.300 2.7e-03
lung adenocarcinoma -1.100 2.9e-07
spina bifida -1.004 4.6e-02
ovarian cancer -2.300 8.4e-08

Gene RIF (24)

PMID Text
26679603 These findings show the importance of Rad6 in ovarian cancer and emphasize the need for further studies of Rad6 as a potential target for the treatment of ovarian cancer.
26336826 Data show that the ubiquitin-conjugating enzyme E2 RAD6A/B-MDM2 ubiquitin ligase machinery regulates anti-silencing function 1A protein (ASF1A) degradation.
26223869 A novel variant (Chr5.133706925 A > G) residing in the UBE2B gene promoter region confers a high risk for idiopathic azoospermia in a Chinese population.
25384975 RAD6 physically interacts with heterochromatin protein 1alpha and ubiquitinates HP1alpha at residue K154, thereby promoting heterochromatin protein 1alpha degradation through the autophagy pathway
23525009 RNF168, in complex with RAD6A or RAD6B, is activated in the DNA-damage-induced protein ubiquitination cascade.
23378580 UBE2B mRNA alterations are associated with severe oligozoospermia in infertile men.
23079972 UBE2B polymorphisms g.-293T>G, g.20016A>G and g.9157A>G are not associated with male infertility, and the GA haplotype is likely a protective factor for male fertility in Northeast Chinese men.
22705350 beta-catenin and Rad6B interacting regions, were identified.
22547805 The Rad6-Rad18 enzyme plays an essential role in promoting replication through DNA lesions by translesion synthesis in mammalian cells.
22083959 RAD6 can form a ternary complex with MDM2 and p53 that contributes to the degradation of p53.
21549715 Data show that the homodimeric Rad18 RING domain can recruit two Rad6b E2 enzymes, whereas the full-length Rad18 homodimer binds only to a single Rad6b molecule.
21041297 Ubc2/Rad6 ser(120) regulates ubiquitin-dependent N-end rule targeting by E3{alpha}/Ubr1
20378615 Observational study of gene-disease association. (HuGE Navigator)
19548583 Hydroquinone could upregulate the expression of Rad6B in L-02 hepatic cells.
19466589 Rad6B is a fundamental component of postreplication DNA repair and can be used as an independent marker for determining response to neoadjuvant chemotherapy.
18854154 Knockdown of ubiquitin-conjugating enzyme E2B (UBE2B) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18497339 study suggests that the UBE2B gene is associated with male infertility in Indian men
18497339 Observational study of gene-disease association. (HuGE Navigator)
18385908 deletions in this suspected promoter region are associated with increased binding affinity for SP1, and might represent one of several factors required for alteration of UBE2B gene expression
18385908 Observational study of gene-disease association. (HuGE Navigator)
18363965 The SAP domain of RAD18 (residues 248-282) is crucial for binding of RAD18 complexed with RAD6B to DNA substrates.
18339854 Findings reveal a positive regulatory feedback loop between Rad6B and beta-catenin and a novel mechanism of beta-catenin stabilization/activation in breast cancer cells.
17050667 These data reveal a potentially important role for transcriptionally active beta-catenin in the regulation of Rad6B gene expression, and link aberrant beta-catenin signaling with transcriptional deregulation of Rad6B and breast cancer development.
14981545 MCF10A cells stably transfected with antisense RAD6B display hypersensitivity to damage-inducing drugs.

AA Sequence

MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTV      1 - 70
RFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR     71 - 140
VSAIVEQSWNDS                                                              141 - 152
//

Text Mined References (46)

PMID Year Title
26679603 2016 Rad6 upregulation promotes stem cell-like characteristics and platinum resistance in ovarian cancer.
26336826 2015 A conserved RAD6-MDM2 ubiquitin ligase machinery targets histone chaperone ASF1A in tumorigenesis.
26223869 2015 A functional variant in the UBE2B gene promoter is associated with idiopathic azoospermia.
25384975 2015 RAD6 promotes homologous recombination repair by activating the autophagy-mediated degradation of heterochromatin protein HP1.
23525009 2013 RNF168 forms a functional complex with RAD6 during the DNA damage response.
23378580 2013 UBE2B mRNA alterations are associated with severe oligozoospermia in infertile men.
23079972 2012 Genetic association of UBE2B variants with susceptibility to male infertility in a Northeast Chinese population.
22705350 2012 Lysine 394 is a novel Rad6B-induced ubiquitination site on beta-catenin.
22547805 2012 Requirement of Rad18 protein for replication through DNA lesions in mouse and human cells.
22083959 2012 RAD6 regulates the dosage of p53 by a combination of transcriptional and posttranscriptional mechanisms.
21549715 2011 Symmetry and asymmetry of the RING-RING dimer of Rad18.
21329877 2011 WAC, a functional partner of RNF20/40, regulates histone H2B ubiquitination and gene transcription.
21041297 2010 Ser(120) of Ubc2/Rad6 regulates ubiquitin-dependent N-end rule targeting by E3{alpha}/Ubr1.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
20061386 2010 The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines.
19548583 2009 [Effect of hydroquinone on the expression of ubiquitin-conjugating enzyme Rad6B in human L-02 hepatic cells].
19466589 2010 Utility of DNA postreplication repair protein Rad6B in neoadjuvant chemotherapy response.
19410543 2009 RAD6-Mediated transcription-coupled H2B ubiquitylation directly stimulates H3K4 methylation in human cells.
19123975 2008 Direct characterization of E2-dependent target specificity and processivity using an artificial p27-linker-E2 ubiquitination system.
18497339 Novel variants in UBE2B gene and idiopathic male infertility.
18385908 2008 Novel UBE2B-associated polymorphisms in an azoospermic/oligozoospermic population.
18363965 2008 Recognition of forked and single-stranded DNA structures by human RAD18 complexed with RAD6B protein triggers its recruitment to stalled replication forks.
18339854 2008 Rad6B is a positive regulator of beta-catenin stabilization.
17130289 2006 Human SHPRH suppresses genomic instability through proliferating cell nuclear antigen polyubiquitination.
17108083 2006 Human SHPRH is a ubiquitin ligase for Mms2-Ubc13-dependent polyubiquitylation of proliferating cell nuclear antigen.
17050667 2006 Essential role of T-cell factor/beta-catenin in regulation of Rad6B: a potential mechanism for Rad6B overexpression in breast cancer cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16337599 2005 The human homolog of yeast BRE1 functions as a transcriptional coactivator through direct activator interactions.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15359278 2004 Rad18 guides poleta to replication stalling sites through physical interaction and PCNA monoubiquitination.
14981545 2004 RAD6B overexpression confers chemoresistance: RAD6 expression during cell cycle and its redistribution to chromatin during DNA damage-induced response.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14585983 2003 Female lethality and apoptosis of spermatocytes in mice lacking the UBR2 ubiquitin ligase of the N-end rule pathway.
12776193 2003 ZNF198 protein, involved in rearrangement in myeloproliferative disease, forms complexes with the DNA repair-associated HHR6A/6B and RAD18 proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11929833 2002 Rad6 overexpression induces multinucleation, centrosome amplification, abnormal mitosis, aneuploidy, and transformation.
11885984 2002 The NMR structure of the class I human ubiquitin-conjugating enzyme 2b.
10908344 2000 The human RAD18 gene product interacts with HHR6A and HHR6B.
10884424 2000 Dysfunction of human Rad18 results in defective postreplication repair and hypersensitivity to multiple mutagens.
10373550 1999 Human Cdc34 and Rad6B ubiquitin-conjugating enzymes target repressors of cyclic AMP-induced transcription for proteolysis.
8575614 1996 Expression of the ubiquitin-conjugating DNA repair enzymes HHR6A and B suggests a role in spermatogenesis and chromatin modification.
2158443 1990 The human ubiquitin carrier protein E2(Mr = 17,000) is homologous to the yeast DNA repair gene RAD6.
1883845 1991 Mammalian mRNAs encoding protein closely related to ubiquitin-conjugating enzyme encoded by yeast DNA repair gene RAD6.
1717990 1991 Structural and functional conservation of two human homologs of the yeast DNA repair gene RAD6.
1559696 1992 Localization of two human homologs, HHR6A and HHR6B, of the yeast DNA repair gene RAD6 to chromosomes Xq24-q25 and 5q23-q31.